Conserved Protein Domain Family
psbY

?
CHL00196: psbY 
photosystem II protein Y; Provisional
Statistics
?
PSSM-Id: 177095
View PSSM: CHL00196
Aligned: 13 rows
Threshold Bit Score: 44.8231
Threshold Setting Gi: 11467632
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
11467488   1 MDSRLLVIAAPLLVAASWALFNIGRLAIQQIQRLSA 36 
11467434   1 MDSRLLVIAAPLLVAASWALFNIGRLAIQQIQRLSA 36 
11467632   1 MDMRLLIVLLPVLAAASWAGFNIARIALRQLSRLGS 36 
118411235  1 MDTRLLVIAAPVLVAASWALFNIGRLAIQQIQRLSR 36 
118411171  1 MDTRLLVIAAPVLVAASWALFNIGRLAIQQIQRLSR 36 
118411040  1 MDTRLIVIAAPVLVAASWALFNIGRLAIQQIQRLKR 36 
118411093  1 MDTRLIVIAAPVLVAASWALFNIGRLAIQQIQRLKR 36 
149071977  1 MDMRLLIVLFPVLAAASWAGFNIARIALRQLSRLGS 36 
11465672   1 MDSRLLIVLIPVLAAASWAVYNIGRVALQQFRKMTS 36 
90994397   1 MDSRLLVVLIPVLAAASWAVYNIGRVALQQFRKMTS 36 
51209861   1 MDIRLLIVLLPVLAAASWALYNIGRVALQQFRSM-- 34 
299830579  1 MDTRLFVIALPLLVAASWALYNIGRLAIQQIQRLSR 36 
299830430  1 MDTRLFVIAVPLLIAASWALYNIGRLAIQQVQRLSR 36 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap