Conserved Protein Domain Family
ycf46

?
CHL00195: ycf46 
Ycf46; Provisional
Statistics
?
PSSM-Id: 177094
View PSSM: CHL00195
Aligned: 16 rows
Threshold Bit Score: 845.455
Threshold Setting Gi: 51209844
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
269101086   1 MIFEEELLVLLNARYPIIYILTIEEDRLEYTIRNRIVNKSYSSLYVWDFIQGYKLNPIKKEFAKRNPLEALEFIENINSR 80 
189095404   1 MKFSDELILFLKARYPIIYISSHEEDRLEYIVRKSIKSILNRGVYSWDFVDGYKLQPNTTSVGKKNPLQALEFIDTFSPE 80 
149072092   1 MSFTKEFKLLLKARYPLLYIPTTEEERLEYTIRSCIQLYSSRAIYCWDFVDGYTGNPNDNGFATKNPLQALELIEKLTPD 80 
90994380    1 MNFTQDLRLLLKSRYPIIVINTREEDRLEYIIKHSLNCSNSQQVYSWDFVDGYTNNPSDNGYAKRNPLLALEFIENLNNE 80 
11465655    1 MNFIQDLRLLLKSRYPIILINTREEERLEYIIKNQLFCLDNEKVYCWDFVDGYTSNPNDNGYAKRNPLLALEFIEKLDTP 80 
11467638   17 MSFVKDFKLLLKARYPIIYINTYEEERVEYVIKSAIQSFTNRAVYSWDFIEGYCNNPNDNGYAIRNPLQALEFIDKFTLE 96 
11467481    1 MKFNDELILLLKARYPIIYINTIEEDRVEYIIRKHIKANLNRSIYSWDFVDGYTNNPNNEGFAKRNPLQALELIERLTSE 80 
71842235    1 MNFLSDFILLLKARYPLIYVVTAEEERIEYLLKYSTKKYLSRAYYSWDFVEGYKGNPNDTGFATKNPLEALELPDKLTPE 80 
242624328   1 MSFINEFNLLLKARYSLIFIPTVEEDRLEYTIRRCVKLGKNRAIYSWNFVDGFLNTPNNNGTGKKNPLQALEFIEKLADD 80 
242620102   1 MTFIEDFNLLLKARYSIIYISTNEEDRLEYTIRNCIKLGKNRAVYTWDFIDGFLNNPNKKEIGKRNPLQALEFIEKLTVD 80 
269101086  81 TPSIFILKDFKRFLKDLTISRKLRNILQLLKVQPKTIIIVDPE-VQIPNELKDHITILKFNLPTPLEIDAELARLSKSLI 159
189095404  81 TATVFILKDFQKFFSDIAISRKLRNLTRTLKVQPKTIIILAST-ISIPEELGNFITIIDFKLPYVSEIKNELKKLLTALN 159
149072092  81 NPAIFLLKDFNLFLNDISVSRKLKNLVKILRNQTKTIVIIGSD-LTIPDSIKEIVTVVNFQLPQTSEIRKELLRVQESLG 159
90994380   81 SLNLFLLKDFDSFLNEIVLIRKLRNLAKIIKTQSKHIIIISCK-INIPFALNDIITVIDLPLPSLLEIKKEIIRLSKALN 159
11465655   81 YLNLFILKDFDSFFNDLGLIRKLRNLSQIIKTQSKNIIIVSCK-VNIPYTLSDVITIVDLPLPNLSEIKKEITRLSIALG 159
11467638   97 TPLLVLLKDFHLFLNDISVSRKLRNLAKSLRNQSKTIVIIASD-LTIPLNLSDSITILHFPLPKNSEIKKELLRIQESLG 175
11467481   81 TPALFLLKDFNRFLTDISISRKLKNVSRILKLQPKTIIIIGSD-FQIPKELQDLITVLQFNLPVENEITQELTRLVNSLN 159
71842235   81 TGAVFVLKDYDNFLKDFSVIRKLKNLSKTLKTQPKNIIIVSSE-LVIPDPLKDLLVTVEFPLPSYQEIYDELTRLVNSLQ 159
242624328  81 TPVLFLLKDFHKFFNDIAVIRKLRNLSRILQTQPKTIVIVAPEnVTIPLEIRELVTILDFDLPTIEEIRDELKRLLGILD 160
242620102  81 NPALFLLKDFNKFFSDITIARKLRNLSRLLKTQPKTIIIVATK-VDIPDEIRELVTVLEFNLPDTNEIRQELTRLLNLLD 159
269101086 160 LKgrFRKRMVEKIIQACQGLSLEKIRRILGKAIVIYNRMDRNVIPLILKEKRQVISETELLEFWSVKVSLKDVGGAKNLK 239
189095404 160 QE--IDEEFLEILAQACQGLSLERIRRVLAKTIATYKKIDDRSIQIVLKEKSQLISQTEILEFWPSNEKLDYIGGLENLK 237
149072092 160 YP--IPNESIENLVSCCQGLSLERIRRVLSKIIATYKEINVESIDLIFKEKKQIISQTQILEFYPTNQKISDIGGLENLK 237
90994380  160 LN--LNSELVNNITKSCQGLSIDRIRKVITKIIAQYNQIDSRSLPIIIEEKRQIINQTHLLEFYPYSKVNRDIGGLDVLK 237
11465655  160 IV--LDIELVNNLAKSCQGLSVERIRKTITKTIAQYGQLDSRSLPIIIEEKRQLINQTRLLEFYPYKKATEDIGGLDALK 237
11467638  176 YS--LPEHSLDNLVKASQGLSLEKIRRVLAKIIATYKEINVESLDLVFKEKQQLISQTQILEFYNPVTKISDIGGLNELK 253
11467481  160 LT--IDPSLFESLTRACQGLSLERIRRVLSKIIATHKTIDENSISILLSEKKQIISQTEILEYWSVNEKMGNIGGVDNLK 237
71842235  160 QT--VSPETIGNLSVACQGLSMERIRRVLSKVIAQYGEISEQSSPLILEEKKQIIQKTQLLDFCLADKTLSDLGGLSNFK 237
242624328 161 QS--ISNKDLIILIRACQGLSLDRIRRVLSKIIADNGIINSEGVSRILEEKQQIINQTQILEFCTSDTTINDIGGLENLK 238
242620102 160 QD--LEKTDLENLVRSCQGLSIERIRRVLSKIIASNQIIDNSSISIILNEKRQIINQTQILEFCSTSQTLDDVGGLDNLK 237
269101086 240 FWLTQRSEIFSEKAINYGLVAPRGLLLIGSEGTGKSLLAKAIAYEWKLPLLRLDIGRLFAGVVGESESRTREMIRITESL 319
189095404 238 TWLKKRSNCFSEKATNYGLPAPRGLLLVGIQGTGKSLTAKAIANEWNLPLLRLDIGRLFAGIVGESESRVRQMIQISEAL 317
149072092 238 KWLKRRSGALSKRAEDYGLPSPRGLLLVGVQGTGKSLTAKAIANDWGLPLLRLDVGKLFGGIIGESESKMRQMIQLSEAI 317
90994380  238 QWLQKRSRSFSKQSLNYGIPSPKGLLLVGIQGTGKSLTAKAIASDWMLPLLRLDMGKLFGGLVGESESKMREMINISEGL 317
11465655  238 SWLKKRSRSFSKQSFNYGIPTPKGLLLVGIQGTGKSLTAKAIANDWTLPLLRLDIGKLFGGLVGESESRMREMVTIAEGL 317
11467638  254 SWLKFRAASFSKRAEEYGLPIPKGLLLVGIQGTGKSLTAKSIANEWNLPLLKLDVGRLFGGIIGESEARVRQMIQFAETI 333
11467481  238 DWLKKRKTSFTIQASNYGLPTPRGLLLIGIQGTGKSLTAKAIATEWQLPLLKLDVGRLFGGIVGESESRLRQMIDVAETL 317
71842235  238 NWLGLRANAFSQAAIDYGLPYPKGVLLVGVQGTGKSLAAKVIAREWNLPLLRLDFGRLFASLVGQSESRARNMISIAEAL 317
242624328 239 RWLRQRSDSLSEQAQNYGLPVPRGLLLVGIQGTGKSLTAKSIANDWKLPLLRLDFGRLFAGIVGESESRVREMIRITEAL 318
242620102 238 LWLDQRTESFSEKAVSYGLPVPRGLLLVGVQGTGKSLTAKAIAHDWQLPLLRLDFGKLFAGIVGESESRVREMIRVAEAL 317
269101086 320 APCALWIDEMDKTFAdsEMSLDGGTTLRVLGTLATWLAEKKVPVFVIATANDLHLLPLEIVRKGRFDEIFHLNIPSREDR 399
189095404 318 APCVLWIDEIDKAFK--ESKSDSGTTNRVFSTLLTWLAEKQSFVFIVATANDISLLPLEILRKGRFDEIFFIGLPNFEER 395
149072092 318 SPCVLWIDEIDKAFSgmESKGDSGTTSRVLATFITWLSEKKSSVFVVATANNIYSLPPEILRKGRFDEIFFIGLPNQQEK 397
90994380  318 SPCILWIDEIDKAFSglHSQGDSGTSARVFGTFITWLSEKKAPVFVVATANKIQSLPSEMLRKGRFDEIFFLDLPNRQER 397
11465655  318 SPCVLWIDEIDKAFSnlYSQGDSGTSARVFGTFITWLSEKTTPVFVVATANTIQNLPSEMLRKGRFDEIFFLDLPNNEER 397
11467638  334 SPCILWIDEIDKAFTgsNFNNDSGTTKRVFGTFITWLSEKKSPVFVVATANNIDSLPPELLRKGRFDEVFFIGLPDLKER 413
11467481  318 SPCILWIDEMDKAFSnnDSRGDSGTSNRVLATFISWLSEKTKPVFVVATANNVDLLPLEIIRKGRFDEIFFLDLPELEER 397
71842235  318 SPCILWVDEIDKAFAnsQNSGDNGTTNRVLATFITWLAEKKSPVFVVATANNIEWIPAEVIRKGRFDEVFFLGLPSFEER 397
242624328 319 APCVLWIDEIDKSFQqsELKGDSGTTSRVLATFISWLSEKTSPVFVVATANNFQLLPLELIRKGRFDEIFFVDLPTLNER 398
242620102 318 APCVLWIDEIDKSFNqnDAKGDSGTTNRVLATFITWLSEKTSQVFVVATANNFEVLPLELIRKGRFDEIFFVGLPIEDER 397
269101086 400 VLIFEIHLRRFRPQTWKKYDTKKLSKASNKFSGAEIEQTVIEAMYAAFTEKREFTTNDILLAVRKTVPMTRIDPLRAEVV 479
189095404 396 KRIFEIHLSLIRPNSWKSYDIETLSKNTKNFSGAEIRQSIVEGMHHAFDEKREFTTLDVYLGTQQIIPLAQLDKERIELL 475
149072092 398 ELIFKVHLSRIRPKSWQNYDIPLLSEKANKFSGAEIEESIVEAMHIAFSENREFTTDDIVKSIGQFVPLAYTNKEKMDAL 477
90994380  398 ESIFKIHLSKVRPRSWQKYDIHELSLLCNKFSGAEIEQAIIESMHTAFSEEREFSTEDIKIAIKQFVPLAFTDKEQVESL 477
11465655  398 ELIFQIHLARIRPKSWQNYNIKQLSLLCNKFSGAEIEQAIVESMHTAFSEEREFSTEDIKIALEQFIPLAYTDKEQVESL 477
11467638  414 ECIFKVHLKKIRPKSWSTYDTEILSAQSNRFSGAEIEESIYEAMHIAFNENREFTTSDILNSLKRVVPLAYTSQKNIEEL 493
11467481  398 KEIFKIHIQEFRPNSWKLFDYKKLAQLSESFSGAEIRQSIIEAMYQAFDQQREFTTDDICLALKQLIPLAQLENSQTLKL 477
71842235  398 RAIFEVHLQKSRPDNYKNYELELLSKITKNYSGAEIEQVVIEAMRIGFNENREFTTDDLITVVQKFVPLAQTKSSSIKQL 477
242624328 399 EKIFTVLLNQLRPGQINKFNISLLAQESDTFSGAEISQSITEGMFYAFNENREFTTQDILRGLKDIIPLAQIEKQKIKDL 478
242620102 398 KKIFTVLLSQIRPESINDFNIEQLSKKSADFSGAEIYQAIIEGMHIAFNENREFTTNDILHGLTEIIPLAQLEGKKIQAL 477
269101086 480 EGWSSSGRLRMA 491
189095404 476 QNWALSGKIRLA 487
149072092 478 EEWAIAGKVRLA 489
90994380  478 QAWAGDGRARNA 489
11465655  478 QAWAGNGRARNA 489
11467638  494 EDWASAGKIRLA 505
11467481  478 QSWASSGRIRLA 489
71842235  478 MQWAESGNVALA 489
242624328 479 QVWVESGRIRPA 490
242620102 478 QQWALSGRIRTA 489
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap