Conserved Protein Domain Family
ycf35

?
CHL00193: ycf35 
Ycf35; Provisional
Statistics
?
PSSM-Id: 177092
View PSSM: CHL00193
Aligned: 17 rows
Threshold Bit Score: 164.794
Threshold Setting Gi: 189095291
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
189095291   1 MSHFTGLKTNISELILLIKTLDDLNIGWKKKNEVVNLFNGETQKCDLVIEQQNNHQIGFSKNGLVYELIYDEAFWQQSIS 80 
189095353   1 MSHFTGLKTNISELILLIKTLDDLNIGWKKKNEVVNLFNGETQKCDLVIEQQNNHQIGFSKNGLVYELIYDEAFWQQSIS 80 
149072093   1 MSHFSKIHTTLKDLNLLKQSLTDLSVQWDAQSQTVRGYKEQTSFANLVIQQNNNYDIGFTWNGFEYQLVADLQFWQQPWS 80 
90994405    1 MSHFTKIQTTIQDLNLLKHALTDLGLIWQMNSSHIKVGENNQHKVDILIKQDNLSHIGFTWNDNRYHLVADLQLWEQPWS 80 
11465679    1 MSHFTKIQTTIKDLNLLKHALTDLGLIWNTNSFNVKVGENSQHKVDILIKQGNLSHIGFVWNDNQYHLVADLQLWEQPWS 80 
11467421    1 MSHLTQVQTNIVNEEALKKALNALNIKWQDGPQNIKNLYGQEQTVDILIKQKNNFDIGFVKEELEYKLIADLQYWEQPYT 80 
11467637    1 MSHFSKIKTALKDLDLLKQSLNDLAIKWYVKDNIVKGYKDQITFANIVIPQNNNYDIGFVWNGVEYQLVADLQFWQQPWS 80 
71842245    1 MSHFSKIKTKLYDRNILKKSLSDLKLEWTEQNQQIVGYQKQTHDAEIIVKQSNNYDIGFKWNGVEYELVTDLMFWAQPYS 80 
242624360   1 MSHFTRIKTSIRDLSTLQSVLTQLDVSWEKANAPIKGYQNETNNAELVIHQPNSIDIGFAFNGQSYELVADTSFWRQPWS 80 
242620024   1 MSHFTRIQTSIRDLATLQSVLTQLDVSWEKVNVPLRGYQDQTHNAELVIHQANSIDIGFAFNGQEYELVADTSFWQQPWS 80 
189095291  81 VPNFKDQLNTYYSVNLVTKNLNQEGFEVIEQINETNfGNVKIKLNALRY 129
189095353  81 VPNFKDQLNTYYSVNLVTKNLNQEGFEVIEQINETNfGNVKIKLNALRY 129
149072093  81 VESFLDKVSQRYAYNSIIQATKKQGFEAVEEVNQDN-GTIKLTLQRWNP 128
90994405   81 LEVFLDKLSQKYAYYSIIEETKKQGFEKMQQISQKD-GSIKLIVQRWNY 128
11465679   81 LEVFLDKLSQKYAYHSIIEETKKQGFEKAEQVYQKD-GSIKLIVQRWNY 128
11467421   81 VETFLQQLKQQYAYQIILDETINKGFEKLEEEYDKD-GSIRLVVQRWRY 128
11467637   81 VEFFLNKLTQRYAYNSILKMANDTGFHPVNETVKEN-GLIKLTLQRWRP 128
71842245   81 VDKFLNQINQRYAYNSIVQVSERENFNFTQSENSQD-GSIRVLLTRYK- 127
242624360  81 IEGFLDKINQVYAAQLLDQELKNLGFSTVSYVKSEQ-GVIDLVAEKWVA 128
242620024  81 MDLFLDKVNQMYASELLNKELTNLGFTTVSYVKNEQ-GAIDLVADKWVS 128
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap