Conserved Protein Domain Family
psaM

?
CHL00190: psaM 
photosystem I subunit XII; Provisional
Statistics
?
PSSM-Id: 177090
View PSSM: CHL00190
Aligned: 31 rows
Threshold Bit Score: 32.0712
Threshold Setting Gi: 145408443
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
11465861   1 MIDDSQIFVALLFALVSAVLAIRLGKELYQ 30 
11467498   1 MIYDSQVYTVLLIALLASVLAIRLGSTLYQ 30 
11467649   1 MISDTQIFVALILALFSFVLAIRLGTSLY- 29 
51210046   1 MISDSQIFVALLFALVSAVLAIRLGTDLYQ 30 
118410994  1 MIYDSQIYTVLCIALLAGILAIRLGSTLYE 30 
90994586   1 MIDDSQIFVALLFALVSAVLAIRLGKELYQ 30 
149071981  1 MISDTQIFIALILALVSLVLAIRLGRALYQ 30 
189095343  1 -MTDNNIAVALLAALFTLFLTVKLGLDLYA 29 
242620092  1 MLTDNQVFLALVSALVTSILAIRLGATLYQ 30 
299830533  1 MIYDSQVYTALCIALLAAVLAIQLGTTLYE 30 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap