Conserved Protein Domain Family
psaI

?
CHL00186: psaI 
photosystem I subunit VIII; Validated
Statistics
?
PSSM-Id: 177088
View PSSM: CHL00186
Aligned: 103 rows
Threshold Bit Score: 27.2449
Threshold Setting Gi: 237688674
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
7525043    2 TTFNNLPSIFVPLVGLVFPAIAMASLFLHIQKNKIF 37 
11467667   1 MTAAYLPSILVPIIGIIFPGLTMAFAFIYIEQDQIN 36 
11465853   1 MTAAYLPSILVPLVGLIFPALGMALLFIYIERETIA 36 
149071989  1 MTAAYLPSILVPIIGLIFPGLVMAFAFIYIEQDEVA 36 
215400805  1 MTISYLPSILVPLVGIVFPGISMALLFVYIEKDDIE 36 
237688474 21 NLPSILPSILVPLVGLLXXXXXXXXFHLYIQNDDIF 56 
237688537 17 NLXPILPSILVPLVGLLXXXXXXXXSHLYIQNDEIL 52 
237688674 21 NLPSILPSILVPLXXLLXXXXXXXXSHLYIQNDEIL 56 
51210038   1 MTGSYLPSILVPLVGIIFPGISMALLFIYIEEENIS 36 
90994578   1 MTAAYLPSILVPLVGLIFPALSMALLFIYIEKETIA 36 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap