Conserved Protein Domain Family
ycf59

?
CHL00185: ycf59 
magnesium-protoporphyrin IX monomethyl ester cyclase; Provisional
Statistics
?
PSSM-Id: 177087
View PSSM: CHL00185
Aligned: 10 rows
Threshold Bit Score: 599.401
Threshold Setting Gi: 301500855
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
301500855   1 MSSKISI-------GQKAKGERTSLLKPRFYTTDFQALMNYKLDRKRGDMLAILSELRKDYNRFHFVRDNEFsiaKKCIK 73 
11465408    1 MVLNANH-------LQTKKTIKETLLAPRFYTTDFDEISRYDISSNFEEIEAIVNEFRSDYNKKHFIRDEEF---DRHWS 70 
30468168    1 MQTAVQT-----------QTTVQTLLTPRFYTTDFDQMAKYDISKNRAEIEAIVNEFRKDYNQTHFIRDDEF---DQVWT 66 
51209955    1 MSTSQNL---------SQTPVKETLLTPRFYTTDFDEMSKLDISSNIDEFEALLQEFRADYNRQHFIRDQEF---EQSWN 68 
11465743    1 MQTTIQK---------EEAPNRETLLTPRFYTTDFEEMASMNISENEQDFFAILEEFRADYNSQHFIRGEEF---NQSWS 68 
90994469    1 MQTTINN---------GQTSSKETLLTPRFYTTDFEEMANMDISGNQEDFLAILEEFRADYNSEHFIRDEEF---NQSWS 68 
189095338   1 MTNSIINns----eIATKNPAKESLLTPRFYTTDFEEMAQLDISSNIEEIEAILEEFRADYNQQHFIRDNEF---VMDWK 73 
215400819   1 MVNSISKns----nLISKTPAEETLLTPRFYTTDFEEMANLDISSNIEEIKAINEEFRIDYNQYHFIRDKEF---VKSWK 73 
269101067   1 MTKSMNAdkngnngVQTKTPASESLLTPRFYTTDFDAMAKLNVESNKLELEVIIEEFRMDYNQHHFIRDQEF---NQSWS 77 
301500956   1 --------------MKQQTAIKETLLTPRFYTTDFDSMANYQVNRNLLEIESILKELRGDYNRFHFIRDNEF---KQSWS 63 
301500855  74 YLPAETRVMLVEFLERSCTAEFSGFLLYKEIARKLANQNNLLSEGFSLLSRDEARHAGFLNKCLADFDINLDLGFLTKAR 153
11465408   71 QIDAQTKQMFVEFLERSCTAEFSGFLLYKELARKLKEKMPVLAEGFLLMSRDEARHAGFLNKAMADFNLTLDLGFMTKNR 150
30468168   67 QMPESKRQWFKEFLERSCTAEFSGFLLYKELSRRLKDTNPLLAEGFGYMSRDEARHAGFLNKAMADFGVSLDLGFLTKHR 146
51209955   69 NLDSGTKALFVEFLERSCTAEFSGFLLYKELSRKLDKSNPVIAECFLLMSRDEARHAGFLNKAMSDFNLSLDLGFLTKSR 148
11465743   69 NLETKTKSLFIEFLERSCTAEFSGFLLYKELSRKLKDSNPIIAECFLLMSRDEARHAGFLNKAIGDFNLSLDLGFLTKTR 148
90994469   69 NLEHKTKSLFIEFLERSCTAEFSGFLLYKELSRKLKDRNPVIAECFLLMSRDEARHAGFLNKAIGDFNLSLDLGFLTKSR 148
189095338  74 NFDEKTRDLFIEFLERSCTAEFSGFLLYKELSRNLKNINPLLAEGFSFMSRDEARHAGFLNKAMSDFNLTLDLGFLTKSR 153
215400819  74 HFDEKTRSLFIEFLERSCTAEFSGFLLYKELSRNLKTTNPLLAEGFAFMSRDEARHAGFLNKAMSDFNLNLDLGFLTKSR 153
269101067  78 HFDKRTKSLMTEFLERSCTAEFSGFLLYKELSRNLKTKNPLLAEGFAFMSRDEARHAGFLNKSMSDFNLTLDLGFLTKSR 157
301500956  64 TMPEETKQLMVEFLERSCTAEFSGFLLYKELSRKLESKNSLLAEGFALLARDEARHAGFLNKCLGDFNVVLDLGFLTKAR 143
301500855 154 QYTFFSPRLILYATYLSEKIGYWRYITIFRHLQHNYIYRIYPIFKYFEGWCQDENRHGDFFAAILVSQPHLLKGASARLL 233
11465408  151 RYTFFKPKFIFYATYLSEKIGYWRYITIYRHLEKHPEHRIYPIFKFFESWCQDENRHGDFFAAIVKSQPYLLEGFISKLW 230
30468168  147 QYTFFAPKFIFYATYLSEKIGYWRYITIYRHLEAHPKWSVYPIFKFFEKWCQDENRHGDFFAAILKAQPKWITGWASRLW 226
51209955  149 KYTFFAPKFIFYATYLSEKIGYWRYITIYRHLEKHPEHRIYPIFKFFENWCQDENRHGDFFAALLKSQPQLLNNLEARLW 228
11465743  149 KYTFFSPKFIFYATYLSEKIGYWRYITIYRHMEQYPEHRIYPIFKFFENWCQDENRHGDFFAALLKSQPHFLNDWKAKMW 228
90994469  149 KYTFFSPKFIFYATYLSEKIGYWRYITIYRHLEQHPEHRIYPIFRFFENWCQDENRHGDFFAALLKSQPHFLNDWKAKMW 228
189095338 154 KYTFFAPKFIFYATYLSERIGYWRYITIYRHLEKTPEFRIYPIFRFFESWCQDENRHGDFFAAVLKSQPHLLKGWKSKLW 233
215400819 154 KYTFFSPKFIFYATYLSEKIGYWRYITIYRFLEKNPTYRVYPIFRFFESWCQDENRHGDFFAAVLKSQPQLLNTWKARFW 233
269101067 158 KYTFFSPKFIFYATYLSEKIGYWRYITIYRHLEKNPEYRIYPIFRFFESWCQDENRHGDFFAALLKSQPELLNTFVAKLW 237
301500956 144 KYTYFSPRFILYATYLSEKIGYWRYITIYRHLQANPHYRIYPIFRYFEGWCQDENRHGDFFAAVLRAQPHLLSGPLARLW 223
301500855 234 SRFFLVSVFVTMLLNDADRTAFYEYLGLNTFAFDMYVIERTNFTAAKLFPVSLNLYNPLALKFIQQTLTAYQVSQACSQY 313
11465408  231 CRFFLLAVFATMYLNDCQRGEFYKSIGLDPRQFDIYVIQKTNESAAKLFPTVLDLDNPRFFECLDKCACYNKLLLEIDDR 310
30468168  227 CRFFLLSVFVTMYLNDLQRKDFYQLIGLDARAFDWHVIRKTNESAARLFPVVLDVDHVDFVRLMDECACAYA-------- 298
51209955  229 CRFFLLSVFATMYLNDFQRSNFYKSIGLDARQYDMQVIRKTNESASRIFPVALNVDQPKFFQYLDQCAVENKKLIEIDQK 308
11465743  229 CRFFLLSVFATMYLNDFQRIDFYNAIGLDSRQYDMQVIRKTNESAARVFPVALDVDNPKFFKYLDSCACNNRALIDIDKK 308
90994469  229 CRFFLLSVFATMYLNDFQRIDFYNAIGLDSRQYDMQVIRKTNESAARVFPVALDVDNPKFFKYLDTCACDNRALIDIDNN 308
189095338 234 CRFFLLSVFVTMYLNDVQRAGFYASIGLDAKKFDIHVIRKTNQSSARLFPVVLDVENPVFFEYLEICSNINLELVNLNNQ 313
215400819 234 CRFFLFSVFTTMYLNDLQRSDFYATIGLDARKFDIHVIRKTNQSSSRLFPIILDVDNKHFFDYLEICAQTNLNLINLNKS 313
269101067 238 CRFFLLSVFATMYLNDLQRSSFYATIGLDARKFDIHVIKKTNQSAGRLFPIILDVDNPNFFKYLDQCAEANLRLIEVNAK 317
301500956 224 SRFFLLSVFVTMYLNDAQRSGFYEALGLNTASFDLHVMERTNYTASKIFPISLNLYNPFFIEHLERCSSYYQKLMDIEAG 303
301500855 314 SAFWpawn-frlGWLKLIQFLNRCHLGLSIVNIFRLRPRYRKLNSFGTS 361
11465408  311 EQPFfn-----qVLNVFYKFYLYFLLVLNFIMLYFLRTVNCNSFTRMVK 354
30468168  299 ------------HWRETQSVLSLAKIFACLFKLYVIKPINTQALWNTIK 335
51209955  309 YNNW--------FIKKLIKMPIYIKLCSCLIKLYLLPAIPSAHVVSTIR 349
11465743  309 GSQP--------LVKTFMKAPLYMSLILNLIKIYLIKPIDSQAVWNTVR 349
90994469  309 NSPL--------FIKSIVKIPLYFSLFANLLKIYLIKPIDSKTVWNTVR 349
189095338 314 NLNL--------IETTFKKIIGTINLINYLLKLYLLKPVDTENDWETIF 354
215400819 314 ETSV--------IVKLIKKIINLTILIYYLIKLFLLKPIDCEKNWNKIY 354
269101067 318 EKDHyghi-gqnILYFFLRSVNYSIIVTKLLQMMFMKPLDSQKYWNTIY 365
301500956 304 KVSPpsilpspvVSASVYKTFLQCNIAWQFVRLFLLKPRHRKRTPFSAR 352
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap