Conserved Protein Domain Family
ycf12

?
CHL00184: ycf12 
Ycf12; Provisional
Statistics
?
PSSM-Id: 177086
View PSSM: CHL00184
Aligned: 32 rows
Threshold Bit Score: 35.762
Threshold Setting Gi: 11467665
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
108796950  1 MNFEVLFQLTALIFVVAAGPLVIVLLASRSNSgL 34 
118411150  2 VNWQVIGQLVSTGAIMLLGPAIIILLALKKGN-L 34 
11467540   2 INWQVIGQLIATGAIMLAGPAVIVLLALKKGN-L 34 
118410980  2 INWQVLGQLIATGTIMLAGPAVIVLLALKKGN-L 34 
11465851   2 INWQVIAQLVSLGVIVLVGPAVIILLSLKRGN-L 34 
90994576   2 INWQVIAQLVSLGVIVLVGPAVIILLSLKRGN-L 34 
149071988  2 PNLQTVAQLISLFLILTSGPAIIVLIALRRGN-L 34 
189095379  2 VNWQVIGQLLSATLIVLAGPAVIFVLAFKKGN-L 34 
299830520  2 INWQIIGQLVSTGVIMLAGPAVIVLLALKKGN-L 34 
299830314  2 INWQIIGQLLATGTIMLAGPAVIVLLALKKGN-L 34 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap