Conserved Protein Domain Family
petJ

?
CHL00183: petJ 
cytochrome c553; Provisional
Statistics
?
PSSM-Id: 177085
View PSSM: CHL00183
Aligned: 8 rows
Threshold Bit Score: 178.045
Threshold Setting Gi: 215400794
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
51209855    1 MRLLFAFFIICHIFTNNVQLTFAADLDAGEQIFSANCSACHANGNNAIMPDKTLKSDALSENKMNSIEAITNQVKNGKNA 80 
90994391    3 KKLSVLFTVFSFFVIGFAQIAFAADLDNGEKVFSANCAACHAGGNNAIMPDKTLKKDVLEANSMNTIDAITYQVQNGKNA 82 
11465666    3 KTLSVLFTAFSFCVIGFTQVAFAADLDNGEKVFSANCAACHAGGNNAIMPDKTLKKDVLEANSMNGIDAITYQVTNGKNA 82 
11465452    8 KNIIIVVAVTLCALFTNEHVVYSANLEHGEQIFSANCAACHAGGNNVIMPEKTLKAEALEANNIKNISAIANQVKNGKNA 87 
30468224    2 KSLLTFILTTIFCI----QQVWAADLAHGEQIFSANCAACHAGGNNVIMPEKTLKLDALEANQMNSVEAISTQVRNGKNA 77 
189095396   4 FALNLGMLFGACILLSFQAPSFAADIENGEKIFTANCSACHAGGNNVIMPEKTLKKEALEQYGMKSVDAITYQVTNGKNA 83 
215400794   2 KNYIISILISTFLIQSSSSPLLAADINNGQTIFSANCVGCHAGGKNVIDRSKTLGIKALKENDMYSSEKIITQVTNGKSS 81 
269101077   2 KNFFLGFFISCLALISFYNPAEAVDINNGESVFTANCSACHAGGNNVIMPEKTLKKEALGTNSMNSVNAITYQVTNGKNA 81 
51209855   81 MPAFGGRLADEDIENVANYVLNKSENGW 108
90994391   83 MPAFGGRLVDEDIEDAANYVLSQSEKGW 110
11465666   83 MPAFGGRLVDEDIEDAANYVLSQSEKGW 110
11465452   88 MPSF-SRLSDSDIEDVANYVLSKADKGW 114
30468224   78 MPSF-SRLTDSDIEDVANYVLAQAKKGW 104
189095396  84 MPAFGGRLSDSDIEDVANYVLSQTEKGW 111
215400794  82 MPAFGTRLTEEDIEDVASFVLSQATE-W 108
269101077  82 MPAFGGRLSEPDIEDVANFVLSKADQGW 109
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap