Conserved Protein Domain Family
tatC

?
CHL00182: tatC 
Sec-independent translocase component C; Provisional
Statistics
?
PSSM-Id: 177084
View PSSM: CHL00182
Aligned: 20 rows
Threshold Bit Score: 197.509
Threshold Setting Gi: 301500848
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
71842243    7 SQFRQKYGIFPVRTNSVTDD-----EMALSEHIEEFSQRLIFCLVLLTCTTLLCFIDVKEIVRIFQAPAEGIKFLQFSPG 81 
90994455    6 QNNLLTNENIDHVDIPENDI-----PMSITEHLEELRQRTLFVFLFFLFATTISFTQIKIIVAILQAPAVGIKFLQLAPG 80 
11465730    6 QNNLLANINTNSENLPENDV-----PMSITEHLEELRQRTVFVFIFFLLAATISFTQIKIIVEIFQAPAIGIKFLQLAPG 80 
51209967    1 -----MNRNINFNT-----------EMSIFEHLEELRQRIFIAALIFIVITAICFTYMKNISYILQQPAIGIKFLQLAPG 64 
30468175    1 ------------------------mKMPLSQHLEELRYRSFLSLAVWLVLSLICFSQAQSLLLWLQAPAKGVRFLQLQPG 56 
149071998   4 KDSSLIPYAFTFQQNEA--------EMSLAEHLEEVRQRAFWSLTSLLLAITVCLVSVKNIVKLLQEPALGIKFLQFAPG 75 
11465415    1 MADKKANDSF---------------QMSIYEHLEELRQRSIESIVALLISMVVCSLNINILIELIKQPAIGIKFLQLSPG 65 
11467698   39 SNSVLIPYTLNFKQVEA--------EMSLAEHLEEIRQRAFWSFSVLTTMIISCIIFVKNIVKTLQEPAAGIKFLQFAPG 110
242620114   1 MDLKIKDKDFQFRKRNLNLDtd-alELPISEHIEEMRQRSVQFLCFACFTIGIMFLKITPIVELLEAPVEGIKFIQLSPG 79 
242624353   1 MNLVIQKNEFKFSRKKQLNLdsealELPISEHIEEFRQRVFQYLSFAILIIGVFFFRITPIVELLEAPVQEIKFIQLSPG 80 
71842243   82 EYFFASVKIAFFGGILISSPVVIYQILLYTLPGLTKKERDVILPMTIGSGVLFSGGLWFSYAFLVPAALKFFIAYGSDVV 161
90994455   81 EYFFSSIKVAIYCGIVATTPFAVYQVILYILPGLTGKERKIILPLLISSVLLFITGGIFAYFVLAPAALTFLISYGSDIV 160
11465730   81 EYFFSSIKIAIYCGIVATTPFGVYQVILYILPGLTNKERKVILPILIGSIVLFIVGGIFAYFVLAPAALNFLISYGADIV 160
51209967   65 EYLFTSIKVALYSGFLLSSPFIIYQITLFILPGLTKKESNFIVPILFISIILFFSGIVFAYIILVPAALKFLINYGNEIV 144
30468175   57 EIIWTSIKVSLDAGLSLSSPFIIYQIMRFIWPALTKEESRWLLPLVFLSLALFWSGIFFGYFLLVPIAVEVFVRSSQPAV 136
149071998  76 EYFFASLKVATYSALLICSPFIIYQIILFVLPGMTKNERKTILPVVVGSILLFGFGILFGYLVLVPAALNFFINYGSEVV 155
11465415   66 EYFFTSIKITLYLGIILSSPIIFYEIIIFIIPGLTKKERRLLIPILIASGCLFVAGLIFGYIYITPIAVRFFINYGKDMI 145
11467698  111 EYFFASIKVAAYSGILISSPFIVYQILLFVLPGMTKDERKTLLPIIIGSMILFLLGLIFGYYILVPASLNFFIKYGSDVV 190
242620114  80 EYFLSTVKISFYGGLLFSIPFLLSQIIFYILPGLTKSEKGIILPILGTSLILFGIGLLFAYYVLIPAALNFFIGYSSTVI 159
242624353  81 EYFLSTVKIAFYGGLLFSIPFLISQIIFYILPGLTKSEKKIILPILITSVVLFGLGLVFAYFVLIPAALNFFIGYSKTVI 160
71842243  162 EPFWSFDQYFNFVAVLIFSTGLAFQVPVIQIVIGLLGIISGKMMLSSWKYVIVISTILGAIITPSTDPITQILLSGALLA 241
90994455  161 EPLWSFEQYFDFILLLLLSTGLAFEIPIIQLLLGVSGTFSSSQMIRAWRYIIIIATIAGAILTPSTDPVTQLIMSSAVLL 240
11465730  161 EPLWSFEQYFDFILLLLFSTGLAFEIPIIQLLLGISGTVSASQMLLAWRYIIIISTIIGAVLTPSTDPVTQIIMSSAVLA 240
51209967  145 EPIWSFEQYFNFILLLLFSTGIAFQIPIIQVILGILKIFSSSEMYAYWKYIVLGATVIAAIITPSTDPITQIIMSIAILA 224
30468175  137 EAIWSLQAYIDFVWICAIGCAIVFQLPLVQLALARLRLITSTQMLSNWKWVVLVAVSVAAIITPDASGFTQILVTFVLVM 216
149071998 156 EPFWSFEQYFEFIIVLLFSTGIAFQLPVIQVMLGLLKIVSGQTMISVWRYVILGSTVVGAVLTPSVDPLTQILMSSIVLL 235
11465415  146 EPIWSFKEYFDFIILSLFSTAISFQIPIFQILLGSLKIINSKMMLSVWRYVVVGSTIFSAIITPSTDPLIQLFLSVAVMF 225
11467698  191 EPFWSFEQYFEFILVLLFGTALAFQLPVLQLVLGFLRIVSGKTMFSIWRYVILLSTVVGAVLTPSVDPLTQILLSSIILI 270
242620114 160 EPLWSFDQYFDFILFLFYSTGLSFQVPILQIILGLAGIVTGKQMLMSWKYVVLASTIVSAILTPSTDPVTQLCLAGAIIL 239
242624353 161 EPLWSFDQYFDFILFLFYSTGLSFQVPIIQIIVGLAGITTGKKMLNAWRYVILAATIVSAVLTPSTDPVTQLCLTLAIVF 240
71842243  242 LYLSGAGVLILLKK 255
90994455  241 LYFGGIVILLVLKK 254
11465730  241 LYFSGVIILFLLRK 254
51209967  225 LYSSGIIILKILNK 238
30468175  217 LYLLGVLVLKIFGL 230
149071998 236 LYFGGAGIVLLLEK 249
11465415  226 LYFSSILVLKLFKL 239
11467698  271 LYFGGASLVLVVEG 284
242620114 240 LYLTGAGLLTIYKE 253
242624353 241 LYLVGSLVLIFYKK 254
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap