Conserved Protein Domain Family
cbbX

?
CHL00181: cbbX 
CbbX; Provisional
Statistics
?
PSSM-Id: 177083
View PSSM: CHL00181
Aligned: 20 rows
Threshold Bit Score: 543.542
Threshold Setting Gi: 283794869
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
71842300    1 MSLNLQEEYNKTDIQGVIDQLDEDLVGLAPVKARIKEIAALLLVQRLRKNlgLGLNSTSVGLHMSFTGSPGTGKTAVATR 80 
11467655    7 TTVNLQEEYEKRQIQEVLDELDRDLVGLIPVKTRIKEIAALLLVHRLRKL--LGLTSANPGLHMSFTGSPGTGKTTVALK 84 
30468060    8 QTVNLQTEFKQTQIQEVLDDLDRELIGLQTVKTRIREIAALLLVDRLRQK--LGLSSSNPGLHMSFTGSPGTGKTTVARK 85 
90994419   11 TLVNLQEEYDRTQIQEVLNELNQELIGLVPVKTRIREIAALLLIDRLRRK--LELVSGNPGLHMSFTGSPGTGKTTVAMK 88 
11465694   12 TLVNLQEEYDKTQIQEVLNELNQELIGLVPVKTRIREIAALLLIDRLRRK--LELVSGNPGLHMSFTGSPGTGKTTVAMK 89 
11465473   15 TLVNLQEEFNKTKIQEVLDDLNQELIGLKPVKNRIREIAALLLVDRLRQK--VGLSSSNPGLHMSFTGPPGTGKTTVATK 92 
149071987   3 QLVNLQEEYEKRQIQEVLDQLDRDLIGLVPVKSRIKEIAALLIIHRLRKS--LGLSSANPGLHMSFTGSPGTGKTTVAVK 80 
215400788  13 KSLSLKQEYENTKIQRVIDILEEELVGLIPVKTRIREIAALLIIDRLRKK--VDLTSNSPGLNMSFTGSPGTGKTTVALR 90 
269101133  16 KNLNLKQVYLDTEIKKIIDILNEELVGLLPVKTRIQEISALLVIDKLRES--LGFTTGNPGLHMSFTGSPGTGKTTVATR 93 
283794869  11 ALVSLKEEYEERRLQEVFDDLDSELVGLLPIKNRLKEIAALLIVHRLRAH--LGLSFSNPGLHMSFTGNPGTGKTTVALK 88 
71842300   81 MADILFKLGYIKKGHLITVTRDDLVGQYIGHTAPKTKEVLKQAMGGVLFIDEAYYLYKPDNERDYGAEAIEILLQVMENQ 160
11467655   85 MADILFRLGYVRKGHLITVTRDDLVGQYIGHTAPKTKEVLKRAMGGVLFIDEAYYLYKPDNERDYGAEAIEILLQVMENQ 164
30468060   86 MADILYRLGYIKKGHLITVTRDDLVGQYIGHTAPKTKQVLKNAMGGVLFIDEAYYLYRPDNERDYGAEAIEILLQVMENQ 165
90994419   89 MADILHRLGYIKKGHLLTVTRDDLVGQYIGHTAPKTKEVLKQAMGGVLFIDEAYYLYKADNERDYDSEAIEILLQVMENQ 168
11465694   90 MADILHRLGYIKKGHLLTVTRDDLVGQYIGHTAPKTKEVLKQAMGGVLFIDEAYYLYKADNERDYGSEAIEILLQVMENQ 169
11465473   93 MADILYKLNYIKKGHLVTVTRDDLVGQYIGHTAPKTKEVLKKAMGGVLFIDEAYYLYKPDNERDYGSEAIEILLQVMENQ 172
149071987  81 MADILFRLGYIRKGHLVTVTRDDLVGQYIGHTAPKTKEVLKRAMGGLLFIDEAYYLYKPDNERDYGAEAIEILLQVMENQ 160
215400788  91 MADILYKLGYCKKGHMLTVTRDDLVGQYIGHTAPKTKKILKKAMGGILFIDEAYYLYKPDNERDYGAEAIEILLQVMENQ 170
269101133  94 MADILFKLGHSKKGHLLTVTRDDLVGQYIGHTAPKTKEVLKKAMGGLLFIDEAYYLYKPDNERDYGSEAIEILLQVMENQ 173
283794869  89 MADILFRLGYIRNGHLVTVTRDDLVGQYIGHTAPKTKEVLKKAMGGVLFIDEAYYLYKPDNERDYGVESIEILLQVMENQ 168
71842300  161 REDLVVIFAGYKDRMESFYESNPGLSSRVANHIDFPDYTAEELLQIARLLLEEQQYRLTSGAEAALLEYVDKRRQLPLFA 240
11467655  165 RDDLVIIFAGYKDRMDSFYESNPGLSSRVANHIDFPDYTPEELLIIGKIMLEEQQYRLTKESELVLLDYIKLRMKEPHFA 244
30468060  166 RDDLVIIFAGYKDKMDRFYTSNPGLASRVANHVNFPDYTPEELLMIGKIMLQEQQYQMTPEAEKVFLQYIQRRMEQPHFA 245
90994419  169 RNDLVVIFAGYKDRMEKFYESNPGLSSRVANHVDFPDYTSDELLQIAKMMIEEQQYCFTEEADKTLLEYTERRMKQPYFA 248
11465694  170 RNDLVVIFAGYKDRMEKFYESNPGLSSRVANHVDFPDYTSEELLQIAKMMIEEQQYCFTEEADKTLLEYTERRMKQPYFA 249
11465473  173 REDLVIIFAGYKEKMDKFYASNPGLASRVANHVDFPEYRPEELLKIAEMMLQEQQYQLTKEAELVFLDYIKKRMLQPHFA 252
149071987 161 RDDLVIIFAGYKDRMDSFYESNPGLSSRVANHVDFPDYSPEELLHIAKIMLAEQQYRLTAESETVLLDYISLRMQEPHFA 240
215400788 171 RDNLIVILAGYKDRMEKFYESNPGLSSRISNHVDFPNYTAEELLVIGKIMLEEQQYQFVPEAEIAFLDYIKKRKEQPLFA 250
269101133 174 RDDLVIIFAGYKERMEQFYTSNPGLSSRIANHVDFPDYSSEELFIIAKMMLEEQQYQFSPEAEPAFFDYVMKRREQPLFA 253
283794869 169 RDDLVVIFAGYKDSMDKFYASNPGLSSRVANHVDFPDYSLSELLAIAKLMLSDQQYVLTTSSELALCERIKLRLGQPHFA 248
71842300  241 NARTVTNAIDAARMRHANRMFNSGDSILTKADLVTIEEKDIRESSLFSE 289
11467655  245 NARSVRNAIDRARMRQANRMFNAGDKVLTKSDLVTIQPEDLLKSRLFKK 293
30468060  246 NARSVRNALDRARLRQANRIFATPGKKLTKFDLVTIQAEDILKSRLFQ- 293
90994419  249 NARSIRNAIDRARMRQANRIFASGEKVLTKADLVTIEAEDILKSRLFSL 297
11465694  250 NARSIRNAIDRARMRQANRIFASGEKVLTKADLVTIEAEDILKSRLFSL 298
11465473  253 NARSVRNAIDRARMRHANRIFNLSSKIVTKSNLTTIQAEDILKSRLFNT 301
149071987 241 NARSVRNAIDRARMRQANRMFAAGARVLTKADLVTIEPEDFLRSRLFRK 289
215400788 251 NARSVKNALDRARMRHANRIFENGNRILTKADLVNITVEDIKQSRVFTL 299
269101133 254 NARSVRNALDRARMRQANRNFDSGGRILTKADLVTITDADIKASSVFSL 302
283794869 249 NARTIRNIIDQAKMRQASRIFNSGGRVLTKVDLVTLQVEDM-------- 289
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap