Conserved Protein Domain Family
rbcR

?
CHL00180: rbcR 
LysR transcriptional regulator; Provisional
Statistics
?
PSSM-Id: 177082
View PSSM: CHL00180
Aligned: 20 rows
Threshold Bit Score: 421.736
Threshold Setting Gi: 269101128
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
118411233   1 MVLPFTLQQLRIFKAIASEKSFTQAAEILFVSQPSLSKQIKTLENRLGILLLNRTGNKILLTEAGVVFLQYSERILALCE 80 
71842295    2 SDLPFTLDQLKIIKTIHREGSFKTAAKKLYISQPAVSRQVQNLERQLNTPIFYRDKRKARLTETGHILVKYAEQILSLCE 81 
11467486    1 MTLPFTLQQLRILKAIATEKSFTRAAEVLFVSQPSLSKQIKTLESRLNISLLNRENNIVSLTQAGKLFLEYSERILALCE 80 
11467425    4 EELPFSLEQLRILKAIATEGSFKKAAESLYMTQPAISLQIQTLEKKLNIALFDRSGRRALMTEAGHLLLRYGDCILALCE 83 
118411042   1 -MLPFTLQQLRILKAVATEKNFTKAAELLYLSQPSLSKQIKTLEKNLDILLVNRENNKISLTENGKIFLQYSERILALCE 79 
118411173   1 MVLPFTLQQLRIFKAIASEKSFTQAAEILFVSQPSLSKQIKTLENRLGILLLNRTGNKILLTEAGVVFLQYSERILALCE 80 
189095395   2 SDLPFTLDQLRILRAIAIEGSFKKAAESLYLSQPALSLQIKNLEKKLNFALFERQKNTVKLTDSGQLLLRYGNRILGLCE 81 
242620104   4 NYLPYTLEQLVILQTVANDGSFKNAARSLFLTQPAVSLQIQNLEKQLKTTLFDRTKKQIELTESGNLLVRYSNRILTLCE 83 
242624326   4 THLPFTLEQLVIFRAVAYDGSFKNAAQSLYITQPAVSLQIQNLEKQLKTILFDRSKKQVQLTESGNLLLRYGNRILSLCE 83 
299830582   1 -MLPFTLQQLRILKAVATEKNFTRAASVLYISQPSLSKQIKTLEKNLDTLLINRERNKLSLTENGEVLLQYSERILALCE 79 
118411233  81 ESCRALNDLKDGERGNLKVGASQTIGAYLMPRVLTLFAQSYPQINLHIDIDSTRIIAKKVADRSLDIAVVGGDIPTGLKK 160
71842295   82 ETCQALDELKSINSGTLVIGASQTTGTYLMPRLIGIFRHKYPQISIELKVHSTRRISWGVANGEIDLAIVGGEVPPELQG 161
11467486   81 ESCRVLNDLKTGDRGNLIVGASQTIGTYLMPRVLALFAQNHPQINIEVHVDSTRKIAKRVLEGDIDIAVVGGNIPEEIEK 160
11467425   84 ETCHALEDLRNLQGGTLVIGASQTTGTYLMPRLIGLFRQRYPQVTVKLHVHSTRRISWNIANGQVDLAVIGGEVPHELQE 163
118411042  80 ESCRALIDLKNGERGSLTVGASQTIGTYLMPRVLALFAQNYPQIDLKVQVNSTRIVAKNILNREIDIAVVGGEIPLDLKK 159
118411173  81 ESCRALNDLKDGERGNLKVGASQTIGAYLMPRVLTLFAQSYPQINLHIDIDSTRIIAKKVADRSLDIAVVGGDIPTGLKK 160
189095395  82 ETYRALLDLRNLQSGTLIVGASQTTGTYLVPRLIGLFRQRYPQVTIQLQVHSTRRVAWAVANGQIDIGIIGGAIPYELND 161
242620104  84 ESSRALDDLNELQSGKLIIGASQTTGTYLMPKIIGLFRQKYPNINVQLNVDSTRKIAWHIMNRQIDIGIVGGEIPKELKK 163
242624326  84 ESSRALDDLSHLQSGKLILGASQTTGTYLMPKIIALFRQQHPNIQVQLNVDSTRKIAWKAVNGQIDIGIVGGEIPLKLSK 163
299830582  80 ESCRALIDLKNGERGNLTVGASQTIGTYLMPRILALFAQNYPQIDLKVQVNSSRIIAKNIINREIDIAVVGGELSDDLKR 159
118411233 161 NLEIEDFVEDELILIISKSHPFAkkKKKKISKEDLYHLNFITLNSNSTIHKFINNILIQNNIQTAQFNVIMELNSIEAIK 240
71842295  162 TLEIISYAEDELALIIPQAHPFA--TLQSIQKEDLYRLRFIALDTQSTIRSVIENTLTQSGIDSRYFKIEMELNSIEAIK 239
11467486  161 NLKVEDFVNDELILIIPKSHPFAlkKKKKINKDDLYHLNFITLNSNSTIRKLIDNILIQIAFEPKQFNIIMQLNSIEAIK 240
11467425  164 SLTITPYAEDELVLILPKSHPFA--KLESIQKEDLYRLKFIALDAQSAIRKVIDKVLAQNGIDSNLFRVEMELNSIESIK 241
118411042 160 NLTVEKFVEDEFSLIIPKSHPFA--NKKIVTKEDLYHLNFISLNSNSTIRKFIDNILIQNQIDTKQLKIIMQLNSIEAIK 237
118411173 161 NLEIEDFVEDELILIISKSHPFAkkKKKKISKEDLYHLNFITLNSNSTIHKFINNILIQNNIQTAQFNVIMELNSIEAIK 240
189095395 162 ILKITPYAEDELALILPKSHSFS--EVTKIKKDDLYSLQFITLDKNSTIRRVIDDILQQNEIDTRRFKIEMELNSIESIK 239
242620104 164 ILDITPYVEDELALIVPQSHPFV--KTGSIKKEDLYNLKFITLDPHSTIRTVVDDTLSQNGIDVTRLKVEMELNSIEAIK 241
242624326 164 ILDVTPCVEDELALILPQAHPFV--KRTHIKKEDLYSLKFIVLDSGSTIRTVVDDVLVQNGIDVTRLKIEMELNSIEAIK 241
299830582 160 NLTIQPFVYDELSLIISKSHPFA--KEKKINKEDLYCLDFITLNSNSTIKKFIDTILIQNQIETNQLKTILQLNSIEGIK 237
118411233 241 TAVSLGLGAAFVSSSAIEKELELKTVEIITIENIRITRTLSIITNPDSHRSKAFDFFYNELWLLKNL 307
71842295  240 NAVQSGLGAAFVSVSAISKELELGILHWAKIEDVTIKRTLSILINPKRYYANPIKNFEKEIMEILLT 306
11467486  241 TAVSLGLGAAFVSSSAIEKEIELKTIEIVTIEDIKITRILSIISNPECYRSKAVDLFYNELWTLKNT 307
11467425  242 NAVQSGLGAAFVSVSAIAKELELGILHWCRIENITIKRMLSIITNPNRYHSQAARIFSEEILTMFSL 308
118411042 238 TAVSLGQGAAFVSSAAIEKEIELKTIEILKIENIRITRTLSIISNSESYKSKAFEFFSNELKKLKNE 304
118411173 241 TAVSLGLGAAFVSSSAIEKELELKTVEIITIENIRITRTLSIITNPDSHRSKAFDFFYNELWLLKNL 307
189095395 240 NAVQSGLGAAFVSVSAIRKELELGLIHWAKIENVTVKRFICIIENPNRYKSKACEQFFDF------- 299
242620104 242 NAVQSGLGAAFVSVSAITKELELNLLSCVKIEDMKIKRMLCIILNPNRYKTKASENFTNEILTLF-- 306
242624326 242 NAVQSGLGAAFVSVSAITKELELGLLSWVKIDDVTIKRMLSLILNPNRYKSKASESFTNEILTLFLN 308
299830582 238 TAVSLGLGAAFVSSSAIEKEIQLQTIEIIQIENIKINRKLSILSNPDCYKSKAFEFFYLELNRLKNK 304
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap