Conserved Protein Domain Family
cpeA

?
CHL00173: cpeA 
phycoerythrin alpha subunit; Provisional
Statistics
?
PSSM-Id: 100273
View PSSM: CHL00173
Aligned: 3 rows
Threshold Bit Score: 286.252
Threshold Setting Gi: 90994559
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
51210020   1 MKSVITTVISAADAAGRFPSSSDLESIQGNIQRASARLEAAEKLADNHDAVVKEAGDACFGKYSYLKNAGEAGENQEKVN 80 
90994559   1 MKSVITTTISAADAAGRFPSSSDLESVQGNIQRAAARLEAAEKLASNHEAVVKEAGDACFAKYSYLKNPGEAGDSQEKVN 80 
11465834   1 MKSVITTTISAADAAGRFPSSSDLESVQGNIQRAAARLEAAEKLASNHEAVVKEAGDACFAKYSYLKNPGEAGDSQEKVN 80 
51210020  81 KCYRDIDHYMRLVNYSLVVGGTGPLDEWAIAGAREVYRTLNLPTSAYVAAFAFTRDRLCVPRDMSAQAGVEYTTALDYII 160
90994559  81 KCYRDVDHYMRLVNYCLVVGGTGPVDEWGIAGAREVYRTLNLPTSAYVASFAFARDRLCVPRDMSAQAGVEYAGNLDYII 160
11465834  81 KCYRDVDHYMRLVNYCLVVGGTGPVDEWGIAGAREVYRTLNLPTSAYVASFAFARDRLCVPRDMSAQAGVEYAGNLDYII 160
51210020 161 NSLS 164
90994559 161 NSLC 164
11465834 161 NSLC 164
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap