Conserved Protein Domain Family
cpeB

?
CHL00172: cpeB 
phycoerythrin beta subunit; Provisional
Statistics
?
PSSM-Id: 133617
View PSSM: CHL00172
Aligned: 5 rows
Threshold Bit Score: 327.412
Threshold Setting Gi: 149072086
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
11467645    1 MLDAFSRVVTNADAKAAYVGGADLQALKKFISEGNKRLDAVNSVVSNASCIVSDAVSGMICENPSLISPSGNCYTNRRMA 80 
90994558    1 MLDAFSRVVVNSDAKAAYVGGSDLQALKKFIAGGNKRLDSVNAIVSNASCIVSDAVSGMICEXPGLIAPGGNCYTNRRMA 80 
11465833    1 MLDAFSRVVVNSDAKAAYVGGSDLQALKKFIADGNKRLDSVNAIVSNASCIVSDAVSGMICENPGLIAPGGNCYTNRRMA 80 
51210019    1 MLDAFSRVVIDSDTKAAYVGGSNLQALKTFISEGNQRLDAVNSIVSNASCIVSDAVSGMICENPGLTSPGGNCYTNRRMA 80 
149072086   1 MLDAFSRVVTNADSKAAYVGGADLQALKKFISEGNKRLDSVNSIVSNASCIVSDAVSGMICENPSLISPSGNCYTNRRMA 80 
11467645   81 ACLRDGEIILRYVSYALLSGDSSVLEDRCLNGLKETYSSLGVPANSNARAVSIMKACAVAFINNTASQRKLSTPQGDCSG 160
90994558   81 ACLRDGEIILRYVSYALLAGDPSVLEDRCLNGLKETYIALGVPTNSSVRAVSIMKAAAVAFITNTASQRKMATADGDCSA 160
11465833   81 ACLRDGEIILRYVSYALLAGDPSVLEDRCLNGLKETYIALGVPTNSSVRAVSIMKASAVAFITNTASQRKMATADGDCSA 160
51210019   81 ACLRDGEIILRYISYALLAGDPSVLEDRCLNGLKETYIALGVPITSSARAVNIMKASVAAFILNTAPGRKMDTASGDCTA 160
149072086  81 ACLRDGEIILRYVSYALLSGDSSVLEDRCLNGLKETYSSLGVPANSNARAVSIMKACAVAFVNNTASQKKLSTPQGDCSG 160
11467645  161 LASECASYFDKVTAAIS 177
90994558  161 LASEVASYCDRVAAAIS 177
11465833  161 LASEVASYCDRVAAAIS 177
51210019  161 LASEVGSYFDRVCAAIS 177
149072086 161 LASEVAGYFDKVTSAIS 177
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap