Conserved Protein Domain Family
cpcB

?
CHL00171: cpcB 
phycocyanin beta subunit; Reviewed
Statistics
?
PSSM-Id: 100271
View PSSM: CHL00171
Aligned: 6 rows
Threshold Bit Score: 293.058
Threshold Setting Gi: 11467422
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
30468100   1 MLDAFSKVVAQADARGEFLSNTQFDALAKMVADGNKRLDAVAAITANASTIVTNAARSLFAEQPQLIQPGGNAYTNRRMA 80 
11465843   1 MLDAFAKVVAQADARGEFLSNTQLDALSSMVAEGNKRLDVVNKINSNASAIVTNSARALFAEQPQLIQPGGNAYTNRRMA 80 
90994568   1 MLDAFAKVVAQADARGEFLSNTQLDALSSMVAEGNKRLDVVNKINSNASAIVTNSARALFAEQPQLIQPGGNAYTSRRMA 80 
51210029   1 MLDAFAKVVAQADARGEFLSNTQLDALANMVAEGNKRLDIVNKINSNASAIITNSARSLFAEQPQLVQPGGNAYTNRRMA 80 
11465528   1 MLDAFSKVVAQADARGEFLSNTQLDALSKMVADGNKRLDATAAISANAATIVTNAARSLFSEQPQLIQPGGNAYTNRRMA 80 
11467422   1 MLDAFGKVVAQADARGEFISSAQFDALSKLASEGNKRLDAVQGITASAATIVSSAARSLFAEQPQLIAPGGNAYTNRRVA 80 
30468100  81 ACLRDMEIILRYISYAMIAGDSSVLDDRCLNGLRETYQALGVPGASVALGVEKMKEAAISFVNDSSNVTVGDCSALVSEL 160
11465843  81 ACLRDMEIVLRYVSYAMIAGDSSVLDDRCLNGLRETYQALGTPGSSVSVAVQKMKEASVALANDLTGTPQGDCSALVAEL 160
90994568  81 ACLRDMEIVLRYVSYAMIAGDSSVLDDRCLNGLRETYQALGTPGSSVSVAVQKMKEASVALANDLTGITQGDCSALIAEL 160
51210029  81 ACLRDMEIVLRYVSYAMIAGDSSVLDDRCLNGLRETYQALGTPGTSVAVAIQKMKEASVSLANDSNGTPIGDCSSLTAEL 160
11465528  81 ACLRDMEIILRYVSYATIAGDSSVLDDRCLNGLRETYQALGVPGASVALAVEKMKEAAIAFANDSSNVTIGDCSALISEI 160
11467422  81 ACLRDLEIVLRYITYATLAGDSSVLDDRCLNGLRETYQALGVPGSSVAVAIQKMKDAAVSVVNDPSGVTVGDCSALASEV 160
30468100 161 ATYFDRAAKAVV 172
11465843 161 GSYFDRAAVSVV 172
90994568 161 GSYFDRAAVSVV 172
51210029 161 GVYFDRAAVAVV 172
11465528 161 ATYFDRAAKAVV 172
11467422 161 ASYFDRAAAAVV 172
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap