Conserved Protein Domain Family
cpcA

?
CHL00170: cpcA 
phycocyanin alpha subunit; Reviewed
Statistics
?
PSSM-Id: 100270
View PSSM: CHL00170
Aligned: 6 rows
Threshold Bit Score: 291.906
Threshold Setting Gi: 30468099
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
11465844   1 MKTPITEAIASADSQGRFLSNGELQAVNGRYQRAAASLGAARSLTNNAQRLITGAAQSVYTKFPYVTQMPGPTYASSAIG 80 
11467423   1 MKTPITEAIATADNQGRFLSNSELHASFGRFQRAASALEAARSLTSNSQKLIDGAAAAVYQKFPYTTQTFGPQYASTAEG 80 
11465527   1 MKTPITEAIATADSQGRFLSNTELQSCAGRFQRAGASLDAARSLTANAQRLIDGAAQAVYSKFPYTTQMTGPCYASSAIG 80 
90994569   1 MKTPITEAIASADSQGRFLSNGELQAINGRYQRAAASLGAARSLTNNAQRLITGAAQSVYTKFPYVTQMPGPTYASSAIG 80 
51210030   1 MKTPITEAIASADSQGRFLSNGELQSINGRYQRASASLEAARSLTSNAQRLITGAAQSVYTKFPFTTQMPGPTYASSAIG 80 
30468099   1 MKTPITEAIAAADSQGRFLSNTELQACFGRFQRAAASLEAARALTSNAQRLIDGAANAVYSKFPYTTQMTGACYASSAVG 80 
11465844  81 KAKCARDIGYYLRMVTYCLVVGATGPMDEYLVAGLEEINRSFELSPSWYVEALQYIKGSHGLSGQIGNEANVYLDYAINT 160
11467423  81 KAKCTRDIGYYLRIVTYALVAGGTGPLDEYLVAGLEEMNRAFDLSPSWYVEALKYIKANHGLSGQAATEANGYFDYVINA 160
11465527  81 KAKCSRDIGYYLRMVTYCLVAGGTGPMDEYLVAGLEEINRTFDLSPSWYVEALKNIKASHGLSGAAASEANAYINYAINS 160
90994569  81 KAKCARDIGYYLRMVTYCLVVGATGPMDEYLVAGLEEINRSFELSPSWYVEALQYIKGSHGLSGQIGNEANVYLDYAINT 160
51210030  81 KAKCARDIGYYLRMTTYCLVVGATGPMDEYLIAGLEEINRSFELSPSWYIEALQYIKNSHSLSGQAANEANTYLDYAINA 160
30468099  81 KAKCSRDVGYYLRMITYCLVAGGTGPMDEYLVAGLDEVNRAFDLSPSWYIEALKYIKANHGLSGAAASEANAYINYAINA 160
11465844 161 LS 162
11467423 161 LS 162
11465527 161 LS 162
90994569 161 LS 162
51210030 161 LS 162
30468099 161 LS 162
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap