Conserved Protein Domain Family
psaK

?
CHL00164: psaK 
photosystem I subunit X; Validated
Statistics
?
PSSM-Id: 164550
View PSSM: CHL00164
Aligned: 6 rows
Threshold Bit Score: 103.741
Threshold Setting Gi: 11465535
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
11467643   1 MNAELLISLVPQTVAWSAKTSSIMILCNVLCIVSARYIIQNKNKGTALPLSGsFSTFGLPELLATTSLGHIIGSGTILGF 80 
51210022   1 MNLQTLLSMISNTSSWSISTAIIMVICNLLCIGLGRYAIQVRGLGPSIPALG-LKGFGLPELLATTSLGHIIGAGAIIGL 79 
90994561   1 MNILFVLSSVPHTSPWSTQVAMVMITCNLLAIVAGRYAIKVRGLGPSIPVSG-VEGFGLPELLATTSLGHVIGAASILGL 79 
11465535   1 ---MLASYLNLFNTPWNSSISIIMILSNIMAIVVGRYSIKVRGLKPPIAISQ-LKDFGVPELLATMSLGHIIGVGSTIGL 76 
11465836   1 MDILFVLSAVPHTSPWSTQVAMVMITCNLLAIVAGRYAIKVRGLGPSIPVSG-VEGFGLPELLATTSLGHVIGAASILGL 79 
149072088  1 MNADLLIALVPQTVAWSAKTGAVMVLSNILCIVAGRYVIQVKGTGPSLPISGsFAGFGLPELLASTSLGHIVGSGAILGL 80 
11467643  81 SYIGLLS 87 
51210022  80 NSIKIIN 86 
90994561  80 SNVGLIS 86 
11465535  77 KTLNFIT 83 
11465836  80 SNVGLIS 86 
149072088 81 SYVGVLS 87 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap