Conserved Protein Domain Family
rpl13

?
CHL00159: rpl13 
ribosomal protein L13; Validated
Statistics
?
PSSM-Id: 177072
View PSSM: CHL00159
Aligned: 17 rows
Threshold Bit Score: 206.377
Threshold Setting Gi: 118411081
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
11465444    1 MKNPIRMQKDYKLPVWYLIDAQDQILGKIATKAAIILMGKNRSTYSYNSMSANFVIIINSRQVAItgNKNTQKVYKRYSA 80 
118411081   4 LNKTFLPTKNYKNRNWFIIDCKNQKLGRLATIIVSLLKGKTKPHYYPSIDIGDYVILLNADSIII--NENSKHYIVNKPG 81 
299830621   4 FNKTFLPIQNYKNRNWYLIDCKGQTLGRLATTITSLLKGKVKSQYHPSVDTGDYIILVNADSIII--NETSKHYLVYNPG 81 
11467448    1 MNETFIPASDYKKKNWCLIDCKDQKLGRIAVVISRLLSGKQKLHYHPAFDVGDYVVVINAQDMIF--DSQQPRFSVNVPG 78 
242620062   1 --MKTNPLADANNKKWYVIDAKGKTLGRVSTLIATIISGKHKSIYNPSFNCGDYVIAINVEEIQVtgKKASQKIYRRHSG 78 
283794919   1 MNKTIFPKQSIAHPQWFIIDAQEQTLGRISTKIAQTLLGKNNILYTPGYCAQQRVIVVNAKMVKVtgKKKLHKLYCRHTG 80 
149072031   1 MNKTLIKSTHNEPYDWYIVDAADKKLGRLSTEISTVLLGKNSPSFHPSQKIKHAVIVINAEKVQVsgKKRYDKFYKRYSG 80 
242624288   1 -MNSLMSVSPIDTKKWYLIDAKGKTLGRLASIIATIISGRHKSTYVPNINCGDNVVVINVELVKIsgKKSTQKVYRRHSG 79 
299830400   4 LNKTFLPVQDYKNRNWYLIDCKGQTLGRLATIITSLLKGKVKSQYHPSVDTGDYVILINADSIIV--NETSKHYLVYNPG 81 
51209921    1 MNKTYLAPTKNYST-WYIIDAKNKNLGRLSSKIAKLLRGKNSISFTPYVNNKIYIILINSRSINVtgKKFVQKTYKRHSG 79 
11465444   81 KPGatKTESFYHLKKRIPNRILEQAVKGMLPKSVlGKKMFSHLKVYAGDSHPHLAQQPIQLSI 143
118411081  82 KPG--SSLKIKNVSDCLPKFTIERAVKGMLSETE-TKRLMRRLNIYSESSHPHQAQKPIEINI 141
299830621  82 RPG--HSLKIKNVSDCLPKLTIERAVKRMLSETE-SKRLMRRLRIYNDQNHQHQAQNPIEINI 141
11467448   79 RPG----RLLKQVINALPSQLLMTAIYGMLPEGSaKKSLPKRLKIYNGPDHPHAAQNPIKLDE 137
242620062  79 RPGglKIETFEKLQERLPEKILENAVRGMLPKGPlGRELYKNLKVYKGESHPHTSQNPELLVY 141
283794919  81 RPGgfHVKTFEEITHLSPFYTIEQSVKRMLPKNPyGRKLFTKLEIYKDSHHPHTHKKLEKLTP 143
149072031  81 YQGgmTIETFDELQKRIPNRIIEKSVKGMLPKGPlGRNLFTKLKVYAGETHPHSAQKPKIINF 143
242624288  80 RPGslKTETFEELQQRIPERILEKAVKGMLPKGTlGRDMYRNLKVYKGGNHPHVAQNPEVLI- 141
299830400  82 RPG--HALTVKNASDCLPQLTIQRAVKRMLAETE-AKRLMRRLRIYNDEHHQHQAQNPIQVDI 141
51209921   80 YPGglKVQKFNEILNQRPNRILEKSIKGMLPKGIlGRQLFRQLKIYPDNIHPHESQQPKIITF 142
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap