Conserved Protein Domain Family
rpl29

?
CHL00154: rpl29 
ribosomal protein L29; Validated
Statistics
?
PSSM-Id: 177071
View PSSM: CHL00154
Aligned: 9 rows
Threshold Bit Score: 62.4753
Threshold Setting Gi: 11467725
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
90994496   1 MTFPKISDVTNLDSSSLAEEILVIKRELFDLRLKRATRQDFQPHLFKHSKHRLAQLLTVEKSRTKST 67 
299830607  1 MSLPQFTDIISLSNTEISEAIIETETALFNLRFKKATRQNFKSHEIKSTKRRLAQLKTLLTLRLESL 67 
11467462   1 MSTVQFNEMIALPNSEISQAIIQTEKELFQLQFKKATRQPFKPHEIKKAKRRLAQLKTILTSRLDAL 67 
11465430   1 MSLPKIKESQDLTISDLQRETSSVRKSLLILRLKKSARQQIKPHLFIHLHHKLSQLLMLQSIKSKYK 67 
118411067  1 MSLPAFTEISSFSNTEISVAIIETENQLFNLRFKKATRQSFKSHEIKNAKRRLAQLKTLLSLRLENL 67 
11465772   1 MTLPKILDVIQMDDSSLSEEIIAIKRQLFDLRLKRATRQDFKPHLFKHSKHRLAQLLTVEKSRAQSN 67 
299830386  1 MSLPQFTDIISLSNTEISEAIIETENELFNLRFKKATRQNFKSHEIKSMKRRLAQLKTLLTSRLESV 67 
11467725   2 TTNLDSTQLEKLTDTDINDTVLKLKKELFELRLQKATRQEIKPHLFKQKKKLIAKLLTIKSKKS--- 65 
51209935   1 MPLPKIQDIQDFTDKEIEEKIIKLKKEIFDLKLKQATRQNVRSHLFKHKKHQLAQLLTIKKDSNYV- 66 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap