Conserved Protein Domain Family
preA

?
CHL00151: preA 
prenyl transferase; Reviewed
Statistics
?
PSSM-Id: 164542
View PSSM: CHL00151
Aligned: 7 rows
Threshold Bit Score: 401.478
Threshold Setting Gi: 11467424
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
11465734   1 MATSSSLFHPIEKELYSVEHNLKSVAGTRHP-ILYAAAKHLFEAGGKRLRPAIVLLVAKSTSEQQEIKPGQRRLAEITEI 79 
11465411   1 MKVNSKTLQSVKEDLLNIEQTLNKLIKVNNP-ILSAAAKHLLIVESKKIRPAIVLLVAKAIDKNKKIKTSQQRLAEVTEI 79 
90994460   1 MAMSPSLFYPVEQELCSLEKNLKAVAGTRHP-ILYAAAKHLFDAGGKRVRPALVFLVAKATSEKQDINTGQKRLAEITEI 79 
51209963   1 MSISPKALTNIEQDLLILENNLKRMVGAKHP-ILYAAAEHLFKAGGKRIRPTIILLVALSTTQALHILPEHKRLAEITEI 79 
11467329   1 MASITNILAPVENELDLLTKNLKKLVGSGHP-ILSAASEHLFSASGKRPRPAIVLLISKATMENEIITSRHRRLAEITEI 79 
11467424   4 LQTNFNLLTYLYERKEIVEDTLNKSIPRGNPtFIYDSIRYSLSAGGKRIRPILCLASCELAGGTMEMALPT---ACALEM 80 
30468171   1 -------MKLISELLAQNERHIQRLIQSRHA-LLSAAAAHLFQAGGKRIRPTFVLLVSQALGG---ISQSQQRLAEITEM 69 
11465734  80 IHTASLVHDDV--IDECSTRRGEKTVHKLFNTKIAVLAGDFLFAQSSWYLANIGNLEVVKVITKVITDFAEGEIRQGLV- 156
11465411  80 IHTATLLHDDV--VDESIIRRGTKSVNKTFGNKIAVFAGDFLFAQSSWYLANINNLEVVKAISKVITDLAEGELQQNLT- 156
90994460  80 IHTASLVHDDI--IDECTTRRGVKTVHNLFNTKIAVLAGDFLFAQSSWYLANIENLAVVKAISKVITDFAEGEIRQGLV- 156
51209963  80 IHTASLVHDDV--IDECEIRRGVNTVHNAFSTKVAVLAGDFLFAQSSWYLANLNNLEVVKTISKVITDFAEGEIRQGLT- 156
11467329  80 IHTASLVHDDI--LDESDVRRGIPTVHSDFGTKIAILAGDFLFAQSSWYLANLESLEVVKLISKVITDFAEGEIRRGLN- 156
11467424  81 IHTMSLIHDDLpaMDNDSYRRGKPTNHIIYGEDLAILAGDALLAYAFEFIATQTKNVPADLIVKVIAQVAHSVTTSGLVg 160
30468171  70 IHTASLLHDDV--VDEASKRRGIDTVNTRFSNRIAVLAGDFLFAQSSWYLANLNNLEVVKFISKLISDLAEGEMRQTST- 146
11465734 157 ----------HFDPSISIDDYIEKSFYKTASLVAASCRGAAMLND--LNSQMHNDLYLYGKHMGLAFQIMDDVLDIAGST 224
11465411 157 ----------QFNTYYSIIKYLEKSFNKTASLIAASCKSCCLLSD--FDQSLNSKFYNYGKNLGLAFQIIDDILDITSSS 224
90994460 157 ----------HFDPSISIDAYIEKSFYKTASLIAASCRGAAMLNG--SNHQINNDLYLYGKHMGLAFQIMDDVLDITGST 224
51209963 157 ----------CFDETISMNNYIEKSFYKTASLIASSCKAAAILSD--TTTNTQNQFYLYGKHLGLAFQIVDDILDIVGST 224
11467329 157 ----------QFKVDLTLEEYLEKSFYKTASLLAASSKAAALLSH--VDLTVANDLYNYGRHLGLAFQIVDDILDFTSST 224
11467424 161 gqiidlssegKSDTTLETLNFIH--IHKTGALLEAAVLSGALLAG--AKEKDMNRFLRYAQNIGLAFQIIDDVLDIISTE 236
30468171 147 ----------QFSTQFELWAYLEKSFYKTASLFACSAKATCMLSNdhEDNHHHKNMYLLGQHLGIAFQIMDDVLDISGDI 216
11465734 225 KSLGKPSGADFMNGNLTAPILFALTQEGKLDQLIQREFSDERDISLALFLIKKSGGITKAKDLAKEQVQAALCCLQFLPK 304
11465411 225 TALGKMTTSDLKLGNLTAPVLFALTKNSKLFKIIEREFCEKSDISEAINIIKETNAIEESFDLAYEHIEAAINSIKDLPT 304
90994460 225 KSLGKPAGADLINGNLTSPLLFSLTQEASLNDLIDREFCNSTDIASTLFLIKRSGGITKAKDLAKEQVQAALSCLQFLPQ 304
51209963 225 VSLGKPAGSDLKNGNLTAPLLFALEENSELYKLIAREFQHNKDIDKAIEIIKSTNGIQKSYDLAQEHMQASVQALKKIDN 304
11467329 225 EELGKPSCSDLKKGNLTAPVLFALEQNSELIPLIQRQFSEPKDFEYTLQIVEETKAIEKTRELAMEHAQVAIQCLENLPP 304
11467424 237 EKLGKSIGKDLKTQKATYPSFWGVEESIKQAELL----------------------VEEAKEEILYFDNKAI-------- 286
30468171 217 SQMGKTLSADFVSGNLTAPILFALTQEAGLVTLLERECCYTQDAYQVRQMVWDTYGIEQAKDLAFEHMQAALACLASLAP 296
11465734 305 SAPVSSLKELTHFIITRLS 323
11465411 305 SSEKDSLIEIAYDLLNRYK 323
90994460 305 STPVSSLKELTHFIITRLS 323
51209963 305 QVAQKNLTYINNYVMNRLC 323
11467329 305 SSSKEALKLITKYVLERLY 323
11467424 287 -----PLIAIADFIVNRNN 300
30468171 297 SEAKDALYDLANQMISRQR 315
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap