Conserved Protein Domain Family
odpA

?
CHL00149: odpA 
pyruvate dehydrogenase E1 component alpha subunit; Reviewed
Statistics
?
PSSM-Id: 177069
View PSSM: CHL00149
Aligned: 5 rows
Threshold Bit Score: 640.376
Threshold Setting Gi: 30468172
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
51209964   1 MKNKIILPSSVSSE--YNINSNIVLHLYKDMLLGRCFEDMCAQMYYRGKMFGFVHLYNGQEAVSTGVIKVLQKDDYVCST 78 
11465733   3 YPKKVELPLTNCNQ--INLTKHKLLVLYEDMLLGRNFEDMCAQMYYKGKMFGFVHLYNGQEAVSTGVIKLLDSKDYVCST 80 
30468172   1 ---------------------MWQLKLYRDMVLGRKFEDQCAQMYYRGKMFGFVHLYNGQEAVSTGVIQALAEHDYVCST 59 
90994458   3 YPKKVQLPLTNYNStgLNLNKSNLLVLYEDMLLGRNFEDMCAQMYYKGKMFGFVHLYNGQEAVSTGVIKLLNPTDYVCST 82 
11465412   3 NRQDCNLEA-------NKISSQLALTFYYDMLLGRGFEDACAQMYYRGKMFGFVHLYNGQEAISTGVIKSLKTTDYVCST 75 
51209964  79 YRDHVHALSKGVPANLIMAELFGKETGCSRGRGGSMHIFSAAHNFLGGFAFIGEGIPISIGAAFQSVYRKQILNDLQPMR 158
11465733  81 YRDHVHALSKGVPSQNVMAELFGKETGCSRGRGGSMHIFSAPHNFLGGFAFIAEGIPVATGAAFQSIYRQQVLKEPGELR 160
30468172  60 YRDHVHALSKGVSPKEVMAELFGKQTGCSKGRGGSMHLFSAPHRFLGGFAFIGEGIPIALGAAFSSLYQHNLWGV--PMS 137
90994458  83 YRDHVHALSKGVPSKNVMAELFGKETGCSKGRGGSMHIFSAPHNFLGGFAFIAEGIPVATGAAFQSIYRQQVLKETEDLR 162
11465412  76 YRDHVHAISKGVPPRSVMAELFGKETGCSRGRGGSMHLFSSFHRFLGGFAFIGEGIPIALGSAFKSMYSQQVCKSVQELD 155
51209964 159 VTACFFGDGTSNNGQFFECLNMAVLWKLPIIFVVENNQWAIGMAHNRSTSFPEIHKKAEAFGLPGIEVDGMDVLAIREVA 238
11465733 161 VTACFFGDGTTNNGQFFECLNMAVLWKLPIIFVVENNQWAIGMAHHRSSSIPEIHKKAEAFGLPGIEVDGMDVLAVRQVA 240
30468172 138 VTACFFGDGTSNNGQFYECLNMAVLWKLPMIFVVENNQWAIGMAHHRSTSEVEIYEKAKMFGMPALEVDGMDVLAVHEVA 217
90994458 163 VTACFFGDGTTNNGQFFECLNMAVLWKLPIIFVVENNQWAIGMAHHRSSSIPEIHKKAEAFGLPGIEVDGMDVLAVRQAA 242
11465412 156 VTVCFLGDGATNNGQFFECLNMAGLWNLPVIFVVENNQWAIGMAHHRSTSQVEIYKKAAAFGINSCEVDGMDVVAVHKTA 235
51209964 239 ISAVDRARFGHGPTLIEALTYRFRGHSLADPDELRSVSEKEAWLARDPIKRLKNYISDNSLCSEKEVEDVNLAVKIEIDQ 318
11465733 241 EKAVERARQGQGPTLIEALTYRFRGHSLADPDELRSRQEKEAWVARDPIKKLKKHILDNQIASSDELNDIQSSVKIDLEQ 320
30468172 218 KEAVERARSAKGPTLIEALTYRFRGHSLADPDELRAKQQKAIWMARDPITQLSSWLIEQELVTQEQLDKIHREIDIIISD 297
90994458 243 KQAVQRARQGDGPTLIEALTYRFRGHSLADPDELRSRQEKEAWVARDPIKKLKKYILDNEIANIGELNEIQNAVKTELEQ 322
11465412 236 KEAILKARKGDGPTLIEALTYRFRGHSLADPDELRSKNEKDIWISRDPIKNFQSYVIRNKLLSQKQLIKVKDEVTQTIND 315
51209964 319 AVEFAISSPEPNIKDLKKYLFSD 341
11465733 321 SVEFAMSSPEPNISELKRYLFAD 343
30468172 298 AVQFALSSEEAK--DLYQYVYAS 318
90994458 323 AVKFAISSPEPNMSELKRYLFAD 345
11465412 316 ALQFAIISPEPKLQDLHKYVFTH 338
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap