Conserved Protein Domain Family
psaD

?
CHL00145: psaD 
photosystem I subunit II; Validated
Statistics
?
PSSM-Id: 177067
View PSSM: CHL00145
Aligned: 19 rows
Threshold Bit Score: 219.246
Threshold Setting Gi: 301500982
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
149072004   3 ETLNLQIPSPTFEGSTGGWLRAAEVEEKYAITWTSPKEQVFEMPTGGAAIMRQGENLLYLARKEQCLALATQVKNsFKIT 82 
11465745    3 DTINLNMPSPTFGGSTGGWLRAAEVEEKYAITWTGKNESKFEMPTGGTATMRDGENLLYLAKKEQCLALGTQLKGkFKIS 82 
11465402    3 QSLNLKMPSPEFYGNTGGWLRSSDIEEKYAITWSSKNEDIFEIPTGGVAKMKAGDNLLYLAKKEQCLALGNQLKIkFKIL 82 
90994471    3 DTINLNMPSPTFGGSTGGWLRAAEVEEKYAITWTGKNESKFEMPTGGTATMRNGENLLYLAKKEQCLALGTQLKSkFKIS 82 
71842310    4 DVLNLQIPTPTFGGSTGGWLRAAEIEEKYAITWTSKKEQIFEMPTSGAAIMQKGENLLYLAKKEQCLALSTQLRTlFKIS 83 
11467707    3 ETLNLQIPSPTFEGSTGGWLRAAETEEKYAITWTSPKEQVFEMPTGGAAIMRKGENLLYLARKEQCLALGTQVKTsFKIT 82 
30468164    1 -MLNLKMPSPSFLGSTGGWLRCAETEEKYAMTWSSDQQHIFEMPTGGAAVMNSGDNLLYLARKEQALALATQLRTqFKIQ 79 
51209954    3 NTIDLKMPSPTFGGSTGGWLRSAEIEEKYAITWTSKQEQIFEMPIGGAAIMREGNNLLYLARKEQCLALSTQLKMqFKIK 82 
269101090   1 MSLYPSQFMPIFGGSTGGWLRSAEFEEKYVITWNSPKEQLFEMPTAGTALMLLGQNLLYLARKEQCLALGTQLRK-FKIK 79 
242624263   1 MTLDSQIQTPIFEGSTGGWLRAAQVEEKYAITWGSSKSQIFEMPTGGAAIMRTGQNLLYLARKEQCLALGTQLRT-FKIT 79 
149072004  83 DYKVYRIFPSGEVQYLHPKDGVFPEKVNAGRVGVGNVSHSIGKNLNPAQIKFTSKSFNG 141
11465745   83 DYKIYRVFPNGEVQYLHPKDGVFPEKVNAGRASINSVDHSIGKNVNPINVKFTNKATYD 141
11465402   83 NFKIYRIFPNGEAQFLHPKDGVFPEKVNEGRKPIGKIDHNIGKNLNPAEVKFTHKTIF- 140
90994471   83 DYKIYRVFPNGEVQYLHPKDGVFPEKVNTGRASVNSVDHSIGQNINPVDVKFMNKATYD 141
71842310   84 DYKIYRIFPNSEVQYLHPKDGVFPEKLNEGRIGVGNVGYSIGKNPNPVNVKFTGKNTFD 142
11467707   83 DYKIYRIFPSGEVQYLHPKDGVFPEKVNPGRIGVGNVSHSIGKNLNPAQIKFTNKSFCD 141
30468164   80 DYKIYRIFPSGEVQYLHPKDGVLPYQVNKGREQVGRVKSTIGKNVNPAQVKFTSKATYD 138
51209954   83 DFKIYRIFPNSEVQYLHPKDGVFPEKVNPGRVGIGNIDHSIGKNEDPVNKKFTGKATYE 141
269101090  80 DYKIYRIFPGGEIQFLHPKDGVFPETSNEGRVPVGKRDFSIGKNPNPASIKWK------ 132
242624263  80 DYKIYRIFPSGEVQYLHPKDGVFPEKSNEGRIQVGKRDFSIGKNPNPVTVKFSGKESFE 138
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap