Conserved Protein Domain Family
odpB

?
CHL00144: odpB 
pyruvate dehydrogenase E1 component beta subunit; Validated
Statistics
?
PSSM-Id: 177066
View PSSM: CHL00144
Aligned: 11 rows
Threshold Bit Score: 615.981
Threshold Setting Gi: 124112068
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
11465413    1 MSMMFLYEALRAAIDEEMGKDSNVFIVGEDVGHYGGSYKVTKDLHVKYGDLRVLDAPIAENSFTGMAIGAAMTGLRPIVE 80 
108796799   1 MSEMLLFEALREGLQEEMDRDPKVLVMGEDVGHYGGSYKVTKGFAEKYGDLRLLDTPIAENSFTGMAIGAAMTGLRPVVE 80 
108796697  14 MAEVLLFEALRQGLQEEMDRDPRVMVMGEDVGHYGGSYKVTKGFAERYGDLRLLDTPIAENSFTGMAIGAAMTGLRPVVE 93 
51209965    1 MTEVLMFDALREATDEEMQNDSSVFILGEDVGHYGGSYKVTKDLHSKYGDLRVLDTPIAENSFMGMAIGAAITGLRPIVE 80 
108773225   1 MSEKLLYEALNEGIHEEIERDPKVFVIGEDIGHYGGSYKVTKGLFEKYGNLRILDTPIAENSFTGIAIGAAMTGLRPIIE 80 
11465732    1 MSKVFMFDALRAATDEEMEKDLTVCVIGEDVGHYGGSYKVTKDLHSKYGDLRVLDTPIAENSFTGMAIGAAITGLRPIVE 80 
124112068   1 MAVRFLFEALQKAIDEEMEREKRVVLIGEDIGHYGGSYKVTQGLYGKYGKHRVIDTPIAEYSFVGAAVGAAATGLIPVVE 80 
30468173    2 LHKLFMYEALREAIDEEMARDKRVFVLGEDVGHYGGSYKVTKQLHTKYGDLRVLDTPIAENSFTGMAIGAAMTGLKPVVE 81 
11466393    1 MTVRFLFEALNMAIDEEMARNDKVALLGEDIGHYGGSYKVTQNLYAKYGEHRVIDTPIAENSFVGAAIGAAMTGLVTVVE 80 
90994457    1 MSKIFMFDALRAATDEEMAKDPTVCVIGEDVGHYGGSYKVTKDLHSKYGDLRVLDTPIAENSFTGMAIGAAITGLRPIVE 80 
22711921    1 MAEVLLFEALRDALDEEMQRDPSVLVMGEDVGHYGGSYKVTKGFHEKYGDLRLLDTPIAENSFTGMAIGAAMTGLRPIVE 80 
11465413   81 GMNMGFMLLAFNQISNNLSMLQYTSGGNFNIPVVIRGPGGIGKQLAAEHSQRLESCFQSIPGLQIVACSTAYNAKGLLKS 160
108796799  81 GMNMGFLLLAFNQIANNAGMLHYTSGANFTIPIVIRGPGGVGRQLGAEHSQRLESYFQSVPGLQLVACSTPINAKGLIKS 160
108796697  94 GMNMGFLLLAFNQIANNAGMLHYTSGGNFTIPIVIRGPGGVGRQLGAEHSQRLESYFQSVPGLQMVACSTPYNAKGLIKS 173
51209965   81 GMNMSFLLLAFNQISNNAGMLRYTSGGNFQIPIVIRGPGGVGRQLGAEHSQRLEAYFQAIPGLKIVACSTPYNAKGLLKS 160
108773225  81 GMNMGFLLLAFNQIANNAGMLHYTSGGNFTTPLVVRGPGGVGRQLGAEHSQRLESYFQSVPGLQMVACSTPYNAKGLIKS 160
11465732   81 GMNMSFLLLAFNQISNNAGMLRYTSGGNFTLPLVIRGPGGVGRQLGAEHSQRLEAYFQAIPGLKIVACSTPYNAKGLLKS 160
124112068  81 GMNMAFILLAYSQISNNMGMLCATSGGHFQVPMVLRGPGGIGKQLGAEHSQRLESYFQSVPGLQIVTCSTPYNAKGLLKS 160
30468173   82 GMNLSFLLLAFNQISNNAGMLHYTSGGNWSIPLVIRGPGGIGKQLSAEHSQRIEAYFQAVPGLKIVACSTPYNAKGLLKA 161
11466393   81 GMNMGFILLAFSQISNNMGMLSATSGGHYHIPIVLRGPGGVGKQLGAEHSQRLECYFQSVPGLQIVACSTPYNAKGLLKS 160
90994457   81 GMNMSFLLLAFNQISNNAGMLRYTSGGNFTLPLVIRGPGGVGRQLGAEHSQRLEAYFQAIPGLKIVACSTPYNAKGLLKS 160
22711921   81 GMNMGFLLLAFNQIANNAGMLHYTSGGNFKIPIVIRGPGGVGRQLGAEHSQRLESYFQSVPGLQMVACSTPYNGKGLLKS 160
11465413  161 AIIEKKPILFLEHVLLYNLKGFVPDEEYYLPLDKAEVVRSGSDVTIVTYSRMRYHVLAAVEKLVLNGQDPEIIDLISLKP 240
108796799 161 SIRSENPVILFEHVLLYNLKETIPDNEYLVCLEKAEIVRPGTDITILTYSRMRHHVLQATKSLVYKGYDPEIIDIVSLKP 240
108796697 174 AIRSDNPIILFEHVLLYNLKEDLAEEEYLVCLEKAEVVRPGNDITILTYSRMRHNVLQATKSLVYKGYDPEIIDIVSLKP 253
51209965  161 AIRDNNPVIFFEHVLLYNLKDELPNDEYFLPLDKAELVRDGLDVTILTYSRMRHHVMQAVVDLVNDGYNPEVIDLISLKP 240
108773225 161 AIRSQNPIIFFEHVLLYNIKENIPQKEYLVPLEKAELVRSGNQITILTYSRMRYHVLQAAKTLIEKGYDPEIIDIISLKP 240
11465732  161 AIRDNNPVVFFEHVLLYNLQEEIPEDEYLIPLDKAEVVRKGKDITILTYSRMRHHVTEALPLLLNDGYDPEVLDLISLKP 240
124112068 161 AIRSKNPILFIEHVLLYNLKGEVPDNDYLLPLEKAELVREGSDITVLTYSRQRYNVIQAVKVLVEEGYDPEVIDLISLKP 240
30468173  162 AIRDNNPVLFLEHVLLYNLKQEIPKQEYVLPLDKAQVVREGSDVTIITYSRMLHHVMQAVKQLVAQGMNPEVIDLISLKP 241
11466393  161 AIRSKNPIFFLEHVLLYNLKAEVPDNDYVLPLEKAEIVRQGNDITILTYSRMRYNVIQAVKVLVEKGYDPEIIDLISLKP 240
90994457  161 AIRDNNPVVFFEHVLLYNLQEEIPQEEYFLPLNKVEFVRKGKDITILTYSRMRHHVIQALPALLKEGYDPEVIDLISLKP 240
22711921  161 AIRNDNPVIFFEHVLLYNLNENLIEQEYLLCLEKAEVVRPGNDITILTYSRMRHHVLQAAKVLVNKGYDPEIIDILSLKP 240
11465413  241 LDLHTISKSIKKTHKIVIVEECAQTGGIAAELISLINTYLYDELDSPAVRLSSKDVPIPYNGNLEKSTLIQPDQIVDVVT 320
108796799 241 VDLGTISTSIKKTHKVLIVEECMRTGGIGASLRATIMEHLFDFLDAPIMCLSSQDVPTPYSGPLEELTVIQPAQIVQAVE 320
108796697 254 FDLGTIGASVCKTHKVLIVEECMRTGGIGATLRAAIMEHFFDYLDAPILCLSSQDVPTPYSSPLEELTVIQPNQIIQVVE 333
51209965  241 LDITSIAQSLMKTHKLIIVEECMKTGGIGAEIIAQINDNYFDFLDAPIVRLSSQDIPTPYNGKLEKATVIYPQQIIEAVK 320
108773225 241 LDMGTISTSLRKTHKVLIVEECMKTGGIGTTLKSAILESLFDFLDTPIMSLSSQDVPTPYNGFLEDLTVIQPSQIVEAAE 320
11465732  241 LDIDSISVSVKKTHRVLIVEECMKTAGIGAELIAQINEHLFDELDAPVVRLSSQDIPTPYNGSLEQATVIQPHQIIDAVK 320
124112068 241 FDMETIGKSIQKTHKVLIVEECMMTGGISNVLQSLIIDNFFDALDAAPLILSSPNVPTPYTGPLEEATVVQTIDIIESIE 320
30468173  242 IDLETLVTSVSKTHKAIIVEECMQTGGIAAEVMAQIYSHAFDELDAPIRRLSSKDVPTPYNGYLEQACLVQPTQIVEAVK 321
11466393  241 FDIETIGKSIQKTHKVLIVEESMMTGGISNVLQSLILENFFDDLDNRPMCLSSPNVPTPYSGPLEEVSIVQTADIIESVE 320
90994457  241 LDIDSISISVKKTHKVLIVEECMKTAGIGAELIAQINEYLFDELDAPVVRLSSQDIPTPYNGSLEQATVIQPSQIVDSVK 320
22711921  241 LDMGTISLSVRKTHKVLIVEECMRTGGIGASLRAAILEDLFDYLDAPIQCLSSQDVPTPYSGPLEELTVIQPNQIIQAVE 320
11465413  321 NLLQYKT 327
108796799 321 QLCNNGN 327
108796697 334 QLCEN-- 338
51209965  321 SIV---- 323
108773225 321 KIILYS- 326
11465732  321 NIVNSSK 327
124112068 321 YGITGKP 327
30468173  322 TLMST-- 326
11466393  321 QILTNKM 327
90994457  321 SIITSVK 327
22711921  321 EMCKIE- 326
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap