Conserved Protein Domain Family
rpl3

?
CHL00143: rpl3 
ribosomal protein L3; Validated
Statistics
?
PSSM-Id: 177065
View PSSM: CHL00143
Aligned: 22 rows
Threshold Bit Score: 221.038
Threshold Setting Gi: 301500876
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
242624269   1 MPLGLLGNKIGMTQIVDERGNMVPVTIL-RAGPCIVTQIKTVEVDGYEAVQVGYNQVSSKFLTKPQIGHLEKVGVPLLRY 79 
11467717    1 MKIGLLGTKLGMTQIFDDNGSAIPVTIL-KVGPCYVTNLKSDTKDNYNAIQIGYQQVDAKKLTKPQLGHLQVNNLPPLKH 79 
11465780    1 MSVGILGTKVGMTQFFDETGLSIPVTVI-QVGPCVITQIKSMSTDGYNAIQVGYKQVVEQKLSKPLLGHLKKSQSPPLKY 79 
301500983  14 LQTGLAASRRRKHTQF-------------CSKPSETVQSLTLATRKNEPMLLGQISDITELVPRRFQESGPVFQVPREGA 80 
11465422    4 VDFCTFGVKLGMTQILDNFGNLVPVTIVsQPKPCVITRVTTSLNSQ-QKLIIQIGCYSDFRANKPTIGYFKKQSVPNLRY 82 
11467343    1 MSIGILGTKLGMTQIFDEAGNAIPVTII-QAGPCPITQIKTTATDGYNAIQVGYRETKEKNLTKAQLGHLQKTNNSALRV 79 
51209943    1 MKIGLLGKKIGMTQIFDPGGKALPVTIL-KLGPCLITDIKKMESHGYAAIQIGYVKVNGNKLNKAQIGHLNKYNMPLVKF 79 
149072009   1 MIPGILGTKLGMTQIFDESGLAIPVTVI-KAGPCILTQIKTQESDSYQAIQIGFSEVKESSLNKPLLGHLKKSQAPALKH 79 
30468182   24 LLMSLLATKIGMSQLFDEKGNALPVTWV-KSGVHEVIDHRTPEKHGYTALVVRYQ-----------------------HW 79 
283794897   3 MNFGILGTKVGMTNVFDPSGVAIPGTIV-KVGPCIVTQVKTVPKEGYSSIQLGYFSVAKASLSKPELGHLKISNSQAVRY 81 
242624269  80 LHEYRIDSTEQVTLGQTISVDM-FKSG-DLVDITGKTIGKGFAGLQKRHNFGRGPMTHGSKNHRAPGSIGAGTTPGRVYP 157
11467717   80 LKEYKVDATHTFTIAQQLDVSI-FELG-QIVSVSGVSIGKGFAGTVKRHNFTRGPMTHGSKNHREPGSIGQGSTPAKVHK 157
11465780   80 LREYLVESIEDFEVSQVFSTNI-FEVG-QKVNVSSKSIGKGFSGYQKRHHFSRGPMSHGSKNHRQPGSIGAGTTPGRVYP 157
301500983  81 SRQEPLRSSEQVPVWTPSSESAlLPTGpRLVCIRGVGKGHGFAGVVSRYGFSRGPMTRGSKHHRAPGSAGAGTFPSRVYP 160
11465422   83 LHEFQTYKNNEYQVGKSLDLKE-LDQ--QLVQVSAYTIGKGFAGYQKKHKFSRGAMSHGSKSHRRPGSIGAGTTPGRVFP 159
11467343   80 LQEFSIESSDSIEVEKPITVEL-FNDN-DIVNIQGYSIGRGFSGYQKRHNFARGPMSHGSKNHRLPGSIGAGSTPGRVYP 157
51209943   80 LKEYKVASTENYQIGKWITVED-LSIN-QNISVSGTSIGKGFTGCIKRHNFSRGPMSHGSKNHRQPGSIGAGTTPGKVFA 157
149072009  80 LKEYRVKSVEGLEVAQKITLDS-FEVG-KTVSVSGKTIGKGFAGTVRRYSFTRGPMTHGSKNHREPGSIGQGSTPGKVHK 157
30468182   80 IREFRVKHLSAYPIGRRLDLSTcFQIG-QKVSVKAKTIGKGFAGYQKRHHFARGPMSHGSKNHRQPGSIGAGTFPGRVFP 158
283794897  82 LREFRVDSPDENLLGQEVTVSK-FSVG-DRVSVAGKSVGKGFSGTVKRHHFTRGPMTHGSKNHREPGSIGMGTTPGRVFP 159
242624269 158 GKKMAGHLGAKKVTIKKLKILFVDAENNLIVVLGSVPGKSGNLISLQPYK 207
11467717  158 GKKMAGRLGGHQVTTKNLTVVHLDKDNNVLVLKGCVPGKRGNILSIK--- 204
11465780  158 GKNMAGQMGNKKVTIKNLQIVSINIENDLLLLKGAVPGKQGALVKVSK-- 205
301500983 161 RKKMPGRWKTSRRKYNRVRPLKLDVRHSLLWLQGSVPGKTGNIIQISPV- 209
11465422  160 GVKMAGRLGFSRRSIKNLLVLKVDLTNKLFLLKGSVPGKYGNLLLVSLKK 209
11467343  158 GTRMAGRKGDSKITIRGLKIVKVDSERSLLIVKGSVPGKPGGLLTITQVK 207
51209943  158 GKKMAGRMGGKKVTIQNLKIIDIKINNNLIIVKGSVPGKPGNIVSIYQ-- 205
149072009 158 GKKMAGRLGGKQSTIKNLEIVHVNTDNNILVVKGAVPGKKGNILSIQQEE 207
30468182  159 GTRMAGRLGGNFCTIKGLEILQI--QNDQMALKGAVPGKVGNLLRIE--- 203
283794897 160 GKRMAGRLGGKKVTIKNLRVVFVSLENNFLVLKGSVPGKKGSLLRILGTK 209
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap