Conserved Protein Domain Family
rps17

?
CHL00142: rps17 
ribosomal protein S17; Validated
Statistics
?
PSSM-Id: 177064
View PSSM: CHL00142
Aligned: 21 rows
Threshold Bit Score: 79.7049
Threshold Setting Gi: 11465431
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
283794906  1 MPIKERTGVVVSNKMDKTAVVSVVSRGTHGKYGKIVCKTKLYKVHDETNICSIGDLVTINESKPLSKTKRWILAFVKQKT 80 
149072018  1 MPIKERLGVVVSDKMDKTIVVSIESRVTHKRYGKITSKTKRYKVHDEMNECK-GDYILIKETRPLSKTKRWALKAVKRKS 79 
11467726   1 MSIKERLGLVISDKMDKTVVVSIANRVTHKRYGKIVTKTKKYKVHDPNNNCQVGDLILINETRPLSKTKRWMFKEIKQKS 80 
242624276  1 MVSRQKTGIVVSDKLNKGIVVTVDTRYKHRLYGKTMSKNKRYLVHDPENLGKVGDVVLVEEHKPISAKKRWILKTVLN-- 78 
11467337   1 MASKERVGVVIRNPQEKTVIVAVNNRVRHNKYSKIIIRTKKYQVHDHSHICKLGDEVKISEVKPISKTKRWIISEVLSST 80 
11465771   1 MPLKETTGKVVSDKMNKTIVVAVENRISHRKYAKTMTRTKKYKAHDENNECAVGDIVTIQETRPLSRTKCWTMVNILSKS 80 
51209934   1 MYKKYTIGTVISNKMNKTITVAVKNKAQHLRYKKIITKTNKYYAHDEHNQCYIGDIVKIRPYRPLSKKKRWILIERIIEK 80 
11465431   1 MSAKEIIGIVITKSLDKTAIVKTQSKSSHERYVKIIKKVKKYTVHDRENISRVGDKVIILQTRPLSKTKRWVIKSIL--- 77 
71842322   1 MVAKEKIGTVVSDKMLNTRIVAVSDRVSHKNYGKVITRTKRYVAHDIESNSKIGDKVKIQETRPISKSKNWILVSILEKS 80 
90994495   1 MPLKETTGKVVSDKMNKTIVVAVENRISHRKYAKTMIRTKKYKAHDENNECTIGDIVTIQETRPLSRTKCWTMVNILSKS 80 
283794906 81 FNTN 84 
149072018 80 LQLD 83 
11467726  81 LKLD 84 
242624276    ----    
11467337  81 VNPE 84 
11465771  81 FHN- 83 
51209934     ----    
11465431     ----    
71842322  81 ST-- 82 
90994495  81 FDN- 83 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap