Conserved Protein Domain Family
rpl6

?
CHL00140: rpl6 
ribosomal protein L6; Validated
Statistics
?
PSSM-Id: 177062
View PSSM: CHL00140
Aligned: 21 rows
Threshold Bit Score: 238.269
Threshold Setting Gi: 301500970
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
301500970   5 ANIINRRSLNLVSKAEAVscawiLDRYAgrarVKIENQVHALQRDIPDLVTC--CNGRCFIYFSKKDES-KKARQLQGTL 81 
90994490    1 MSRIGKKIILLPTNLSTQ-----FDGQT----ITVTGPKGTLSRTLPAGINL--EILNDTIAVKTSGQT-KMASQLHGLS 68 
71842326    1 MSRIGKQYISIPDKVNIR-----LEGQK----VFVDGPKGKLTRILPSFICCtiDEPEKKVFLEKAEEN-KLSQALYGLS 70 
11467731    1 MSRIGKLPVKFSEKVTMK-----IDQDN----IIVKGPKGELALGLSKNINI--TIENNTLFVKPVTKE-PQVLKLFGTY 68 
11465436    1 MSRIGKKSILLNQNVQVD-----IKDQV----CIVKGQKGTLQRKLPCNVEL--IKRGPELFIIPVDLDtVKKRRLHGLL 69 
11465766    1 MSRIGKKIVLLPTNISTQ-----FDGQT----ITVNGPKGTLLRTLPEGITL--EINDGTILVQTSGNS-KRANQLHGLS 68 
30468196    1 MSRIGKQVIK-HDQVQIV-----QQDNV----LKVKGKKGDLTLCLPSHVKI--QQNGNQLQVIAESQ-------WQGLY 61 
149072023   1 MARLGKLPVKIPNKVQVS-----IKDNH----VHIKGPKGELSLDITNKVLV--ESVEDTLVIKPALDN-KNAEKLHGTY 68 
51209929    1 MSRIGKKPINLPQNINIT-----IIENN----VQIQGPKGELSYKIPKLIQIkqDTKNNKLFLYKTEDN-KEAQKLHGLC 70 
283794911   1 MSRISKLEVAIPDKIDFS-----VNENK----IKIKGPKGELSRQIPAGVTI--AAFGRSLQLCSTPHV-KNSVELCGTY 68 
301500970  82 SKVLANIIQGIAVGAEVKLRLNGVGYKAKVEQQKLILDVGFSHSVNIPIPPDITASLPDTTSITLSATNKEKLGAFAAKL 161
90994490   69 RTLISNMIEGVSNGFFKKLQIQGVGYRSQIDNQDLILSVGYSHVVKIKPPANIEIKVENNTNITVSGIDKEVVGQVASTI 148
71842326   71 RTLLSNMVTGVSSGWHKKLTIAGVGYRAQLDGKDLILNMGYSHPVKMVTPPALSVSVESPTSITVSGLEKEAVGEFAAKI 150
11467731   69 RAIINNMVVGVTKGFEKRLELQGVGYRAQLQGKDLSLSVGYSHPVVIKAPTGINIAVENNTIVIISGISKELVGQIASNI 148
11465436   70 RTLINNMVIGVSIGFSKKLEIHGVGYKAHIADQHLVLTLGYSHVIKFLPPEGVSLLVENNNIVLVKGIDKEKVGLASACI 149
11465766   69 RTLISNMIEGVSTGFSKKLQIQGVGYRSQIDNNNLILSVGYSHVVTIQPPQNIEIKVENNTSITVLGIDKEVVGQVASSI 148
30468196   62 RSLIDSMVKGVTVGFEKKLLLVGVGYRAQLMENDLVLYVGFSHPITIKAREGIQFELENPTTIVIKGIDKQLVGRVAASI 141
149072023  69 RKLLSNMVEGVSDGFEKKLELQGVGFRSQVQGKSLILNVGFSHQVTIESPPGINLAVENNTNIIVSGIDKQLVGQIAANI 148
51209929   71 RTLINNMIIGVSQGFEKKLQIQGVGYRSQLDGDNLLLNVGYSHTVIVKPPKNIILEVENNTSITIKGIQKEQVGEIAAQI 150
283794911  69 RGLIINMIVGVSSGFKKKLELQGVGYKAHLDNNTLILSVGYSHQVFLKLPLGIQIAIENNTNISVLGIDKELVGHMAATI 148
301500970 162 RQVRPPEPYKGKGIQYVTESVSLKSGKSKR 191
90994490  149 RSIRPPEPYKGKGIRYQGEFVRRKAGKAGK 178
71842326  151 RSVRPPEPYKGKGIAYEGEVIRRKAGKTGK 180
11467731  149 RSIKPPEPYKGKGIRYVGEFVRKKAGKAGK 178
11465436  150 RSIKPPEVYKGKGIRYAGELVRRKLGKASK 179
11465766  149 RSIRPPEPYKGKGIRYQGEVVRTKAGKAGK 178
30468196  142 RALREPEVYKGKGIRYAYESIRLKAGKAGK 171
149072023 149 KSVRPPEPYKGKGIRYAGEYVRRKVGKAGK 178
51209929  151 RRIRPPEPYKGKGIRYLNETINLKVGKSGK 180
283794911 149 RLVKPPEPYKGKGIRYQGEHIRKKIGKAGK 178
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap