Conserved Protein Domain Family
rps5

?
CHL00138: rps5 
ribosomal protein S5; Validated
Statistics
?
PSSM-Id: 177060
View PSSM: CHL00138
Aligned: 22 rows
Threshold Bit Score: 118.169
Threshold Setting Gi: 31442374
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
31442374    1 MIFLNKKIYNKKYIYYKNINLlyfikiindfiffsflikeyikiynlfsfnllknfinllniiaikyilyniynnifnit 80 
118411207   3 TEFNQVNKLKKTPRRNDNLNE----------------------------------------------------------- 23 
189095418   3 EENKNKKLKNQRRPRKKRDFS----------------------------------------------------------- 23 
242620056   1 ------MVQEKNTNRNNNRAN----------------------------------------------------------- 15 
11467454    3 TDLKQVNKSKKALQRNDNLSE----------------------------------------------------------- 23 
299830394   1 MSSDLKKINKKNSRRNNSAQE----------------------------------------------------------- 21 
269101041   1 --------------MTTQNKE----------------------------------------------------------- 7  
283794913   1 -------MLKQKRIAKSHWKN----------------------------------------------------------- 14 
242624282   1 --MVQDTRKSNMSNRAAKRSN----------------------------------------------------------- 19 
299830615   1 MSSDLKKINKKNSRRNPNIQE----------------------------------------------------------- 21 
31442374   81 ttinykiyilelfywenknfinynkyllfNTIEQKILLIKKVSKTRAKGRIKKYKIIIIIG--NKSGWFGIGCSKDYYLQ 158
118411207  24 -----------------------------AKFVERLIKISRVTKVTKGGKKLSFRAVVVIG--DENGKVGVGVGKAEDVV 72 
189095418  24 -----------------------------EKINHKVVQIKRVSKVVKGGKKMSFRAVVVVGidGRTGFVGIGTGKADDVT 74 
242620056  16 -----------------------------TNWVRKVVKVRRITKVVKGGKKLRFGALVIIG--NEKGLVGVGVGKADDVV 64 
11467454   24 -----------------------------SKFVERLIKISRVSKVTKGGKKLSFRAIVVVG--NENGQVGVGVGKADDVV 72 
299830394  22 -----------------------------PKLVERLIKISRVSKVTKGGKKLSFRAIVVVG--DENGKVGVGVAKADDVV 70 
269101041   8 -----------------------------KDWEKRVVKVSRVSKVVKGGKKISFRATVVVG--DMEDKVGVGIGKAEEVS 56 
283794913  15 -----------------------------SEWQEKILQVNRVTKVVKGGKKLSFRVVMIIG--NRKGSVGVGLGKANDVA 63 
242624282  20 -----------------------------VNWVRKVVKVRRITKVVKGGKKLRFGALVIVG--NEQGLVGVGVGKADDVM 68 
299830615  22 -----------------------------PKFVERLIKISRVSKVTKGGKKLSFRAIVVVG--DENGKVGVGVAKADDVV 70 
31442374  159 DAISKARLHAFKNIYQISLFYSNLLKNNIYIKKKFKKLYLFSYNYKIKISSSYIIRLLFYFIGINNFNSKIMG 231
118411207  73 NAFKKAKTDGRKNLIDVPITKSLSIPHAVIGDLGACKIIMRPSIEGSGVIAGGAVRTVLEVAGIKNVIAKQLG 145
189095418  75 NAINKAVAKGKRNLINIPITKTETIPHSVTGIFGASNVIIRPSAPGSGVIAGSSIRTVLEVAGIRNVLAKQLG 147
242620056  65 EAVKKAANDGRRNLIMVPLTKTFSIPHVSTGQFGASNVLLKPASAGSGVIAGGSVRTLLEAAGVQNIMAKQLG 137
11467454   73 NAFKKAKADGRKNLIKIPITKSLSIPHNVIGIFGACKIIMRPSIEGSGVIAGGSVRTVLEVAGIKNVIAKQLG 145
299830394  71 NAFKKAKTDGRKNLIDLPLTKSLSIPHHVVGQFGACKVIMRPSIEGSGVIAGGAVRIVLEVAGVKNVIAKQLG 143
269101041  57 TAIKKAETDAKKNVITVPIAEGKTIPHATVGIECGSKVFIRPAVPGTGVIAGGSVRIVLELAGIKNILSKQLG 129
283794913  64 SAVKKAGADAKKHILTIPISRSDSIPHMTMGKAGAASVIIRPSSPGSGVTAGGSLGMILRLAGVRNVLAKRLG 136
242624282  69 EAVKKATNDGKRNLIRVPLTKNSSIPHIVNGQYGACNVLIKPASEGTGVIAGGSVRILLEAAGVQNILAKQLG 141
299830615  71 NAFKKAKTDGRKNLIELPLTKSLSIPHNVVGNFGACKVIMRPSIEGSGVIAGGAVRIVLEVAGVKNVIAKQLG 143
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap