Conserved Protein Domain Family
rps13

?
CHL00137: rps13 
ribosomal protein S13; Validated
Statistics
?
PSSM-Id: 177059
View PSSM: CHL00137
Aligned: 20 rows
Threshold Bit Score: 160.573
Threshold Setting Gi: 11465441
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
269101038   1 MVRFLGRDLANNKKIKYALTAIYGIGLSRAKEILEKAGLEnvdkEGVRTKDLSDEDISNLRKVLEK-DYQLEADLYRLTN 79 
12751544    1 MVRLIGVDLPRNKRIAYALTYIHGIGITSARKIIELAEIS----PETRTDDLTTEQTIALRDQLESiDLNLEGDLRCFNG 76 
118411078   1 MVRLVGVDLPRNKRIAYALTYIHGIGLTSARKIIEIANIN----PETRTVDLTTEETVALRQTLEEsDLKLEGDLRRFNG 76 
11465441    1 MVRIAGRELPTNKRVDIALNYIYGIGPWRSRQILKELKVD----FSTRVKDLLVGEIAAIREYIER-NYVVESDLRRFEL 75 
118411210   1 MVRLLGIDLPRNKRIAYALTYIHGIGLTSAQKFIELAEIS----ADTRTDDITTEQAVVLRNLLENcELNLEGDLRRFNG 76 
242620059   1 MVRISGIDLPNSKRIEYALTSVYGIGLTTSRSILAVADID----PSKRTNVLGDTEVMALREVIEE-NYKVEEDLRRQTK 75 
215400753   1 MVRLIGIDLPKGKYINYALTSIYGIGISRAEEILSKIGLDkfsiKKLKVEDLSDTNISALRKILED-EYQLEGDLRRLKS 79 
299830397   1 MVRLVGVDLPRNKKIAYALTYIHGIGLTTAKQIIETADID----SEVRVYDLTTEQTVALRQTIEEsDLKLEGDLRRFTG 76 
189095415   1 MVRIAGVDLPSQKKILYSLTAVYGIGLHTAKKILEKAKVD----SEIRTFELDDDSVGNIRSVLED-NYTVEGDLRKLKS 75 
299830618   1 MVRLVGVDLPRNKKIAYALTYIHGIGLTTAKKLIELAEID----SDLRVYDLTTEQAVALRQTIESsDLKLEGDLRRFTG 76 
269101038  80 LNIKRLMENGSIKGRRHRAGLPVRGQRTRTNGRTRRGGKKTVAGKNK 126
12751544   77 LNIKRLNEINCHRGKRHRNNLPVRGQRTRTNARSRRGSKKTVTGKKK 123
118411078  77 LNIKRLNEINCHRGKRHRNNLPVRGQRTRTNARSRRGSKKTVTGKKK 123
11465441   76 LNIKRLIEINSYKGKRHKMLLPVRGQRTRTNARTRRGVKRIIDLKGV 122
118411210  77 LNIKRLNEINCHRGKRHRNSLPVRGQRTRTNARSRRGAKKTVTGKKK 123
242620059  76 QNIVRLSQINCVKGRRHRQNLPVRGQRTRTNSRTRRGARLM------ 116
215400753  80 LNLKRLMEIGSIKGRRHRVGLPVRGQRTRTNARTRRGTKKTVAGKKK 126
299830397  77 LNIKRLNEINCHRGKRHRNSLPVRGQRTRTNARSRRGAKKTVTGKKK 123
189095415  76 LNINRLVSINCFRGKRHRQGLPLRGQRTRTNARTRRGSKKTMAGKKK 122
299830618  77 LNIKRLNEINCHRGKRHRNSLPVRGQRTRTNARSRRGAKKTVTGKKK 123
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap