Conserved Protein Domain Family
rpl31

?
CHL00136: rpl31 
ribosomal protein L31; Validated
Statistics
?
PSSM-Id: 177058
View PSSM: CHL00136
Aligned: 20 rows
Threshold Bit Score: 117.059
Threshold Setting Gi: 301500976
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
301500976  1 MAKRNLHPQWFPQTQVFCDGVLVMVTAATKERLTVDTWSGNHPAYKSQDGIsVQKNPNVQSFLNRRAGY 69 
242620064  1 MPKKDLHPEWYENSEVYCDGQLVYTVSSTKEKLNVDIWSGNHPYYTGSKKL-LDTEGRVDRFMKKYNLE 68 
242624290  1 MPKKNIHPEWYDDCSVYCDGQLVHTVASTKPSLNVDIWSGNHPYYTGSKKL-LDTEGRVDKFMKKYSLD 68 
11467446   1 MPKPEIHPTWFNETPIVCDGKPLCYIGSTKSELQVDIWLANHPFYTDSQTI-IDSEGRVERFMKKYGIN 68 
149072033  1 MPKKDIHPKWYDDTKVYCDGQLVMTVGSTKPELSVDIWSGNHPFYTGSQKM-LDTEGRVERFMRKYGIE 68 
299830623  1 MPKSDIHPTWSKDTPVLWDGKPLCFVGSTKKELQVDIWLANHPFYTKSQVV-VDSEGRVERFMKKYGLN 68 
299830402  1 MPKSDIHPTWSNETPVLCDGKPLCLIGSTKHELQVDMWLANHPFYTKSQVV-VDSEGRVERFMKKYGLN 68 
11467741   1 MPKQNLHPKWYAEAKVYCDGQLIMTIGSTKSELNVDIWSGNHPFYTGSQKM-LDTEGRVERFMRKYGLK 68 
118411083  1 MPKSDIHPTWFENTKVLCDGKPLCLIGSTKSELQIDMWLANHPFYTNSQVL-IDSEGRVEKFMKKYRLD 68 
11465446   1 MAKKNIHPQWYEEAKFYCNGEIVKIIGSTRMEINADIWSGNHPFYIGTQKI-VDTEGRIDKFIRKYNLN 68 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap