Conserved Protein Domain Family
rps10

?
CHL00135: rps10 
ribosomal protein S10; Validated
Statistics
?
PSSM-Id: 177057
View PSSM: CHL00135
Aligned: 20 rows
Threshold Bit Score: 147.057
Threshold Setting Gi: 242624294
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
11467442    1 MEIKTNAKIRVRLESFNHELLTSACRKISDTIQN--SDATKLSVVSLPTDKRIYCVLRSPHVDKDSREHFELRVHKRVIE 78 
11465450    5 LNDFHEAKVRIKLSSYSASLLNLSCNNVLQSIKE--SNTSVKGPVFLPTRRRVYCVLRSPHVNKDSREHFEIRSHFRIID 82 
299830627   1 MEIKTNAKIRVRLESFNHELLVASCKKISETLSN--ASLNSVGLVTLPTSKRIYCVLRSPHIDKDSREHFEVRVHKRVLE 78 
118411219   1 MEIKPNEKIRVRLESFNHELLNTSCQKIMEITQN--NNVDNVGVVSLPTDKRIYCVLRSPHVNKDSREHFEIRTHKRILE 78 
242620068   2 SSLNKHIKTRVRLESFDHKLLTIACNSLIDGISS--INGIAKGPIPLPTKKRIYCVLRSPHVDKKSREHFEIKIHKRLLE 79 
269101029   1 ---MSNEKIRITLQSFNHLVLNECCKKISDVLTGekSVLKIAGPISFPTKKRSYCVLRSPHVNKDSREQFEIRRYKKIID 77 
118411087   1 MEMKTDAKIRVRLESFNHELLNSSCQKIVNILQN--TLSNSIGVITLPTRKRIYCVLRSPHVDKDSREHFEIRTHKRILE 78 
215400744   1 --MITREKIRISLYSFNSKILEEACKKIFSIISPiiNSENIKGPIPLPTRKRIYCVLRSPHVDKDSREQFEIRRYKRIID 78 
30468210    1 ------MKIRLKFYSYSAQLVQSSLDQMAQIASQ--TA--QVSKVCLPTKRKIFCVLRSPHVNKDSREHFEIRIHRRLLE 70 
242624294   4 NSQDVYTVTRIKLKSFDSELLNIACDTLVESIKN--IEGRIVGPIRLPTSKHHYCVLNSPHVDKKSREQFEISEYRRLLD 81 
11467442   79 IYYDPTvkCRIISKFRITVRSIISY 103
11465450   83 ISSCSS--ETIEMLMRLDLPTGVNI 105
299830627  79 IHYDSEv-PIFDLLTEIDLAPGVFY 102
118411219  79 ISYDSSv-NIFDLLVKSDLPPGVLY 102
242620068  80 IYTPQNveNIADSFLKIAIPPGVSI 104
269101029  78 IESNSK--EIVNVLLSLDLSPGVST 100
118411087  79 IYYNSEv-PIFDLLSEADLPPGVFY 102
215400744  79 IYPESS--QTLDTFLKIELPPGVSF 101
30468210   71 LKNASA--ATIDALMKVDLAYGVEV 93 
242624294  82 IYTPKNmnNLIDSFLTIPIPPGVIV 106
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap