Conserved Protein Domain Family
petF

?
CHL00134: petF 
ferredoxin; Validated
Statistics
?
PSSM-Id: 177056
View PSSM: CHL00134
Aligned: 17 rows
Threshold Bit Score: 168.36
Threshold Setting Gi: 215400743
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
215400743   4 PKEHKITIYLDKlKSQEETLQIADDVYILDACESAGIDLPYSCRAGACSTCAGKLLEGKVDQSDQSFLDDDLLKKGFILT 83 
118411098   1 MATYKVTLISEE-HDINATIDCNDDVFVLDAAEEAGIDLPYSCRAGACSTCAGKVSDGTIDQSEQTFLDDDQMGAGFVLT 79 
11467557    1 MATYKVTLLSEE-HDIDATIDCNDDVFLLDAAEEQGIELPYSCRAGACSTCAGKVTEGDIDQSEQTFLDDDQVGAGFVLT 79 
299830547   1 MVTYKVTLLSEE-HDINSTIDCNDDVFVLDAAEEQGIELPYSCRAGACSTCAGKVTSGEIDQSEQTFLDDDQVEAGFVLT 79 
189095442   1 -MTFNVQLLSEE-HGIDVIVSCASDQYILDAAEVAGIDLPYSCRAGACSTCTGVLSKGTVDQSEQSFLDDDQMENGFVLT 78 
90994511    1 MADYKIHLLCEE-EGIDVTFNCAEDTYILDAAEEEGIELPYSCRAGACSTCAGKVTEGTVDQADQSFLDDDQLLAGYVLT 79 
118411008   1 MVTYKVTLLSEE-HDINTTIDCNDDVFVLDAAEEQGIELPYSCRAGACSTCAGKVTAGEIDQSEQTFLDDDQVEAGFVLT 79 
299830342   1 MVTYKVTLLSEE-HDIDSTIDCNDDVFVLDAAEEQGIELPYSCRAGACSTCAGKVTAGEIDQSEQTFLDDDQVEAGFVLT 79 
11465786    1 MADYKIHLLSED-EGIDVTFDCSEDTYILDAAEEAGIELPYSCRAGACSTCAGKVTEGSVDQSDQSFLDDEQLLKGYVLT 79 
51209914    1 MSDYNVTLLLE--DDKTATIKCPDTTYILDQAEESGYELPYSCRAGACSTCAGKLVSGTIDQDDQSFLDDDQIQEGFVLT 78 
215400743  84 CVAYPKSDCKIQANAEEELY 103
118411098  80 CIAYPKSDCTILVHQEDELY 99 
11467557   80 CIAYPKSDCTVLVHQEDELY 99 
299830547  80 CIAYPKSDCTILVHQEDELY 99 
189095442  79 CVAYATSDCTILVHKEDDLY 98 
90994511   80 CIAYPSSDCTISTHVEQELY 99 
118411008  80 CIAYPKSDCTISVHQEDELY 99 
299830342  80 CIAYPKSDCTILVHQEDELY 99 
11465786   80 CIAYPESDCTILTHVEQELY 99 
51209914   79 CIAYPTSDCTILTHQESSLY 98 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap