Conserved Protein Domain Family
psbV

?
CHL00133: psbV 
photosystem II cytochrome c550; Validated
Statistics
?
PSSM-Id: 177055
View PSSM: CHL00133
Aligned: 21 rows
Threshold Bit Score: 267.706
Threshold Setting Gi: 301500870
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
90994390    1 MLKRSSWLAALLGLLTVVSTSTHTYAIELDEATRTVPLESSgRTVILTPEQVKRGKRLFNNSCAICHNGGITKTNPNIGL 80 
30468223    1 MIRVIMLLVLVWMTPMIS-------------WATEVVKDVSgQKVEVNADQLKRGKRLFNTHCSACHVGGITKTNPNIGL 67 
11465453    2 NRISIYRIKVLAFLFAVSTYVYPASSLELNEEARTVKLNSEgQSLTLNEEQIKKGKRLFNSHCGSCHVGGITKTNPNVGL 81 
149072081   1 MLKKISSLAFVFGLALTVFSSSSVNAIDLDENTRTIPLDSSgTTVVLTTEQVK-GKRLFNSSCGNCHVGGITKTNPNLGL 79 
11465665    1 MLKRSSWLATLLGLLTVASVSTIVYAIELDEATRTVPLESSgRTVVLTPEQVKRGKRLFNNSCAICHNGGITKTNPNVGL 80 
215400795   1 MLKKFFSLGLIISLFCWNFLNSQVLAIELDEATRTVAQDNSsKTIVLSPEQVKRGKRLFLATCSTCHTGGITKTNPNLGL 80 
51209854    2 IPNRKIQLSLFAVIIVFETLLNQVYAMELDEATRTVTLEESgKTITLTPEQVKRGKRLFNNSCAQCHNGGITKTNPNIGL 81 
11467659    1 MFKKFSALFTLLFTLCLV-NPMLVYSIDLDENTRSVPLDDAgNTVILTPEQVKRGKRLFNASCGQCHVGGITKTNPNLGL 79 
269101076   1 MFKKFFTSLIIVSLLNLG--TSSVLAIELDEATRTIPATSDgKTIVLTPEQVKRGKRLFNSSCGQCHVGGITKTNPNLGL 78 
71842311    2 ALKSKFLVGSILATFILNGFSSPAQALELDEDTRTVTLDGKgNTVVLSVEQIKRGKRLFNNACAICHVGGLTKTNPNVGL 81 
90994390   81 DPESLGLATPQRDTIEGLVDYMKDPTSYDGAESIAELHPSIKSAEIFPKMRNLTDEDLFTIAGHILLQPKIVSEKWGGGK 160
30468223   68 DLESLSLATPARNNLDALVDYMKNPTTYDGSESIAQIHPSIASSDIFPKMRDLSEDDLYAIASHILTQAQIQAEKWGGGK 147
11465453   82 DLESLNGANPPRNNINALVEYMKDPKTYDGSESIAEIHPSIKSADIFPKMRDLSDDDLKVIAGHILVQPKINSEKWGGGK 161
149072081  80 EPDALSLATPPRDNVNALIDYMKNPT-YDGLESIAELHPSIKSADIFPKMRSLSDEDLFDIAGHILLQPKLSSEKWGGGK 158
11465665   81 DPESLGLATPQRDNIEALVDYMKDPTSYDGAESIAELHPSIKSAEIFPKMRNLTDEDLFTIAGHILLQPKIVSEKWGGGK 160
215400795  81 DLEALSLATPNRANIDGLVDYMKNPTTYDGLESIAEIHPSIKSADIFPKMRSLSEDDLVAIAGHILIEPKIVSEKWGGGK 160
51209854   82 DPESLSGATPVRDNIRNLIEYIKDPTSYDGATSIAELHPSIKSAEIFPKMRNLTDEDLFAIAGHILIQPKIAAEKWGGGK 161
11467659   80 EPDALSLATPARDNINALVDYMKNPTSYDGLESIAEVHPSIKSADIFPKMRSLSDEDLFAIGGHILLQPKLSSEKWGGGK 159
269101076  79 DTEALSLATPSRNNITGLVDYMKNPTTYDGLESIAEIHPSIKSANIFTRMRSLDENDLVDIAGHILLQPKILSEKWGGGK 158
71842311   82 DVEALSLATPPRDNVSSLVSYLKDPMTYDGADSIAELHPSIKSADIFPKMRSLTDEDLFAISGHILVQPKVVNEKWGGGK 161
90994390  161 IYY 163
30468223  148 IYY 150
11465453  162 IYY 164
149072081 159 IYY 161
11465665  161 IYY 163
215400795 161 IYY 163
51209854  162 IYY 164
11467659  160 IYY 162
269101076 159 IYY 161
71842311  162 IYY 164
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap