Conserved Protein Domain Family
psaF

?
CHL00132: psaF 
photosystem I subunit III; Validated
Statistics
?
PSSM-Id: 177054
View PSSM: CHL00132
Aligned: 18 rows
Threshold Bit Score: 332.779
Threshold Setting Gi: 11465456
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
51209848    1 MKKICVLFCMIILYTSINPInsLAEVETAGLTKCQESPAFTKRLNNSVKKLETRLAKYDANTPPAIALQTQIIKTKIRFN 80 
149072078   4 FFVKNWVSMLLVCSFLAFPS--LAKADVAGLTPCGESKEFARRLDGSVKKLQTRLSKYEAGTPPALALQKQIDKTKNRFD 81 
11465659    1 MKKATFITCLLAVLLVSNPI--VVNAEVAGLIPCKDSAAFNKRMVNSVKKLQARLAKYDANTPPALALNKQIEKTKTRFA 78 
189095444   1 MKKFFTTILLGFLFFTGSLE--PALADISGLTPCKDSPAYAKRLTQSVNKLEGRLKKYEAGSPPALALQDQIERTKVRFE 78 
71842260    1 -MKVLLNWLLVASLFAASPK--AAFADVSGLTPCKDSAVFKKRLDGSVKKLQARLANYTEGTPAYLALEQQIDQTKARFA 77 
90994384    1 ----MCLTCLLALLIMSNPI--IANAEVAGLVPCKDSAAFNKRMVNSVKKLQARLAKYDADTPPALALNKQIEKTKTRFA 74 
30468217    1 MFKRSLIFIAAVMSVCQISAiqISAVSADVLTPCQQSEAFHKREINEVRTLENRQANYEANSPSYLALQSQIDQVHKRFD 80 
11467296    1 MRKLFLLMFCLSGLILTTDIr-PVRADVAGLIPCSQSDAFERRLKNTTQRLENRLKKYEPGSAPAEALQKQIDKTQQRFD 79 
242624267   7 NSILSILFMTFINFANVNKV--NAAPNVGTLVDCGDSPAFQKRLDTSVKKLETRLKKYEPDSPPALALEQQIALTKSRFD 84 
215400716   1 MIQFKKLLMVFLALTFFNPI--TVFADVAGLIPCNESSVFTKRMEISIKKLENRLKKYEAGSPPSLALEQQIKRTQQRFK 78 
51209848   81 KYAKSGILCGTDGLPHLITDGRWNHAGEFMIPGVLFLYITGWIGWVGRGYLRDISQTTKPTEKEIILDVPLALKYCLSGF 160
149072078  82 RYGKAGLLCGTDGLPHLITDGRWTHSGEFVIPGLLFLYVAGWIGWVGRSYVLFARTADKPTEKEIIIDVPVALSFVSTGF 161
11465659   79 TYGRAGLLCGTDGLPHLISDGRWSRAGDFVFPGLLFLYITGWIGWVGRGYLLSVAKTSKPTEKEIILDVPLAVKFMSSGF 158
189095444  79 RYGNSGLLCGKDGLPHLIADGRWDHAAEFTLPGLLFLYITGWIGWVGRKYLRTMSTVANSTEKEIIIDVPVALTIMASGF 158
71842260   78 KYGDKGLLCGADGLPHLIADGRPDHAGEFVIPAFGFLYIAGWIGWAGRSYLQFSKKTDKPNENEIIINVPVALGMMSGAF 157
90994384   75 TYGRAGLLCGTDGLPHLISDGRWSRAGDFVFPGLLFLYITGWIGWVGRGYLLSVAKTSKPTEKEIILDVPLAIKFMSSGF 154
30468217   81 KYGT--LLCGQDGLPHLITDGDWRHAREFTIPALLFLYITGWIGWVGRSYLKYTKETKNPTEQEIILDVPMALKYMLSGF 158
11467296   80 KYRNSGLLCGADGLPHLITDGRWSHAGEFTIPGLLFLYIAGFIGWSGRSYLQAVAASDNSTEKEIIIDIPVALQSVSKGF 159
242624267  85 RYAKSDLQCGKDGLPHLIADGDWNHAAEFTLPGLLFLYTTGWIGWAGRKYIQTVAQTKNPSEKEIIIDVPLALQIMISGY 164
215400716  79 RYSDSGLLCGKDGLPHLITDGRWSHSVEFIIPGLMFIYITGWIGWVGRKYIRTISNLSNATEKEIIIDVPLALKIMSTGF 158
51209848  161 TWPLAAIKELTSGELVADNKDIPISPR 187
149072078 162 IWPFSAFKEFTSGNLIVPADEITVSPR 188
11465659  159 AWPLAAWQEFSSGQLIAPNDDITVSPR 185
189095444 159 NWPLSAWQELTSGNLLANKDEITVSPR 185
71842260  158 LWPLAAWKELINGQLLVPGDEVTVSPR 184
90994384  155 AWPLAAWQEFSSGQLIASNDDITVSPR 181
30468217  159 LWPLSAWQEYRSGQLLAKEDEITVSPR 185
11467296  160 VWPLAALQEFSSGKLTARDEEITISPR 186
242624267 165 IWPVNAWQEFLKGDFVASKSEITVSPR 191
215400716 159 IWPISAWQEYVSGNLLADVTEITVSPR 185
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap