Conserved Protein Domain Family
rbcS

?
CHL00130: rbcS 
ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit; Reviewed
Statistics
?
PSSM-Id: 177052
View PSSM: CHL00130
Aligned: 21 rows
Threshold Bit Score: 168.014
Threshold Setting Gi: 126165883
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
189095348   1 MRLTQGAFSYLPDLTDAQIIKQIDYCLSRGWSVGVEWTDDPHPRNAYWELWGLPLFDVKDSSAILYEVNECRRLNPEGYI 80 
51210007    1 MRLTQGTFSFLPDLTDDQINKQIEYAISQKWSVSIEYTEDPHPRNNYWELWGLPLFDLKDAATVLFEINSCRKQYPNLYI 80 
11465693    1 MRLTQGAFSFLPDLTDQQINKQLAYIVSKGWSANVEYTDDPHPRNAYWELWGLPLFDVKDPAAVMYEINSCRKAKPSYYV 80 
215400782   1 MRVTQGCFSFLPDLSDEQIKKQIEYAVNKGWAISIEWSDDPHPRNTYWELWGLPLFDIKDSSAVLYEITECRRVNPEGYM 80 
126165876   1 MRVTQGTFSFLPDLTNDQIRKQIQYAINKGWALSVEYTDDPHPRNSYWEMWGLPLFDVKDPAAIMFEVEACRKEKSNYYI 80 
71842226    1 MKLTQGCFSFLPDLTDEQITKQIQYALNKSWALSIEYTDDPHPRNNYWEMWGLPLFDMKDPAAVLFEINMCKKAKPNFYV 80 
30468059    1 MRVTQGTFCYLPDLTDEQIRKQIQYAINQGWAVSVEYTDDPHPRNSYWEMWGLPLFDVKDPATIMFEVQECRKQFPNHYI 80 
269101142   1 MRVTQGCFSFLPDLSDDQIKQQVAYAMSKGWAVSVEWTDDPHPRNSYWELWGLPLFDVKDPAAVMYELAECRKVNPEGYI 80 
90994418    1 MRLTQGTFSFLPDLTDEQINKQLAYIVSKGLSANVEYTDDPHPRNSYWELWGLPLFDVKDASAVMYEISSCRKAKPNYYV 80 
118411103   1 MRLTQGCFSFLPDLTDAQIEKQVSYAMSKGWAMNVEWTDDPHPRNNYWELWGLPLFDIKDPATVMFELNEARKSCAAGYI 80 
189095348  81 KLVAFNAARGTESSASAFIVQRPKSEPGFYLERTEAEGRMIRYTIHSYAvARNPEGSRY 139
51210007   81 KLNAFDNTRGTESCVLSFIVNRPAYEPGFELVRTEDIGRNQRYSFRSYA-TAKPEGSRY 138
11465693   81 KVNAFDNTRGVESCSMSFIVNRPANEPGFLLQRQDFEGRTMKYTLHSYA-TEKPEGARY 138
215400782  81 KINAFDASIGTESCVMSFIVQRPNEEPGFYLERTEVAGRSIQYTIKSYStQTKPEGFRY 139
126165876  81 KLLAFDSTKGVESTAMSFMVNRPAHEPGFVLRRIESNDRVQRYQIHSYA-TEKPEGERY 138
71842226   81 KCVAFDNTRGTESAVLSFIVQRPAYEPGFRLSRQEVQGRNLVYTLEAYSvSAKPEGERY 139
30468059   81 KVLAFNSTKGIESTALSFIVNRPANEPGFVLRRIESNDRVQRYQIHSYA-TEKPEGSRY 138
269101142  81 KINAFDASIGTESCVMSFIVQRPITEPGFYLERNEVQGRNIQYTISSYAvQARPSGDRY 139
90994418   81 KVNAFDNTRGIESCVMSFIVNRPANEPGFLLQRQDFEGRTMKYSLHSYA-TEKPEGARY 138
118411103  81 RINAFDASYGVESCVMSFITNRPANEPGFYLDRTEGAGRQVIYSIKSYSvQSNPEGSRY 139
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap