Conserved Protein Domain Family
rpl1

?
CHL00129: rpl1 
ribosomal protein L1; Reviewed
Statistics
?
PSSM-Id: 177051
View PSSM: CHL00129
Aligned: 19 rows
Threshold Bit Score: 403.232
Threshold Setting Gi: 11465492
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
11467548    1 MRKLSRRQKENRAKTK-DSIYsNLEDAITILQETATAKFTETVELHANLNIDPKYADQQLRTTVTLPHGIGKTINIAVLT 79 
30468131    1 -MKRSKRYQSLCSLIE-PKLY-SPQEALKLLKKLATAKFVETAEAHIRLNLDPKYTDQQIRATVVLPHGTGKAIRIAVIT 77 
51209890    1 MKKRSRRFSTLLKQIEaDKLY-SPLDALNLMKNLSNVKFIETAEVHIVLGLDPKYADQQLRTTVMLPKGTGKIMRVAVIT 79 
149071970   1 MAKVSQRVKKIQTKVE-LRPY-KGTEALNLLKELATAKFTETAEAHISLKIDTKYADQQLRTTLVLPKGTGKKVRIAVVA 78 
11467612    1 MSKVSKRISEVRNKIE-NKPY-KAIEALNLLKDTATAKFVESAEAHIALKLDTKYADQQLRTTLVLPKGTGKKIRIAVIA 78 
11467315    1 MKKRSRRMQELVGKVE-EQLY-EPLEAIQLLKQISTAKFIETVEVHCRLGIDPKYNDQQLRATVTLPNGTGQTLRVAVIT 78 
90994529    1 MKKFSRRLTTLKSKVE-PKLY-TINEAVSILKATSNAKFKETAEAHIALGLNPKYADQQLRATVILPKGTGKLIKVAVIA 78 
215400735   1 MKTLTKKRKQILSEIN-SKLY-TPLEALTLIKKIASANFIESVEAHIALNIDPRYSDQQLRTTLILPKGTGKIKRIAVLL 78 
189095317   1 MKKLSKRLQKLNNLVE-KKLY-SVDESIKLLKETATASFVESTEAHISLNIDPKYADQQLRTTLVLPNGTGKTVRLAVLI 78 
11465492    2 VKIRSRRFKILQSQISvEKMC-EPIEAINLLKSGPKAKFSETFEVHCCLDLNTKYSDQQLRASVVLPKGTGKRTKIAVIT 80 
11467548   80 NDSNFTEAREAGADRVGSDDLIEEISQGNISFDLLIATPDMMPKLAKLGRVLGPKGLMPSPKSGTVSTTLTATLSEFKKG 159
30468131   78 KQSSHIE----GADLVGSDDLCAQIAQSIINFDCLIATPDMMPTLAKLGKILGPRGLMPSPKSGTVTTNVAEAIQAFRRG 153
51209890   80 QNNKTHEAKSSGADIVGGEDLIDEIKKGRLDFDKLIATPDMMMSIAKLGKILGPKGLMPSPKAGTVTHNLITTIKEFKAG 159
149071970  79 QGEKINEALAAGADLAGAEDLIQNIMKGDLDFDRLIATPDMMPAIAKLGKVLGPRGLMPSPKSGTVTADIKEAIDEFKKG 158
11467612   79 EGEKATEAINAGADLAGSTDLVQDIMKGMLDFDRLIATPDMMPLIAKLGKVLGPRGLMPSPKSGTVTSDVKSAIEEFKKG 158
11467315   79 RGEKINEASTAGADLVGAEELIDEIQNGRLDFDCLIATPDMMPQVAKLGRVLGPRGLMPSPKGGTVTFDLAQAINDFKAG 158
90994529   79 KGEKLTEAISAGADVSGSEELIDEILKGRLDFDKLIATPDVMPLIAKLGRVLGPRGLMPSPKAGTVTLDVAKAVNEFKGG 158
215400735  79 QNELITPEIKKIGDIVGSDILITSITQGQLDFDILLATPDMMPKLAKLGRILGPKGLMPSPKAGTVTTDILSAITEFKGG 158
189095317  79 PDEKIKPEYKQQADIVGSNDLIEKITKGDIDFDILIASPDMMPKLAKLGRVLGPKGLMPSPKSGTVTDDISETINQFKKG 158
11465492   81 NEAEVNKIKNFGVDIVGSKDLVESIANGFLEFDQLLTTPDMMPVIAKVGKILGPRGLMPSPKSGSVTSDIYNAIQEFKKG 160
11467548  160 KFEYKADKAGVVHVSFGKSNFTHSQLMENLTALYKSIEQNRPSGVKGKYFKSLFICTTMGPSIQLDLNIFL 230
30468131  154 QIEYRTDKTGIVHLAFGRMDFNEQHLYDNLVAIKESVETNKPSGASGLYWKSFAIATSMSPSIRLNIQQWS 224
51209890  160 KLEYKIDRSGILHIPFGKLNFNVEDLHINLITLQESIDRNRPQGSKGKYWKSVHINSTMGPSIPLDIQLLR 230
149071970 159 KLEYRADKSGIVHILFGKTDFSVEDLLANLEAVQESIDKNRPSGVKGRYWKSFYICSTMGPSIQLDISEFR 229
11467612  159 KLEYRADKSGIVHISFGKTNFSVNDLLLNLEAVQESIDKNRPAGVKGKYWKSFYICSTMGPSIQLDISEFR 229
11467315  159 KLEFRNDRTGIVHVLFGKANFSEEALLGNLKAVQEAVDRNRPSGVKGKYWKSIYITSTMSPSIEVDYNLLR 229
90994529  159 KVEYRVDRTGIIHVPFGKSSFSQEDLVLNLQTIKESIDRNKPSGAKGKYWKTFFLSSTMGPSIQIDITSLL 229
215400735 159 KVEYRADKTGIVHLNFGKVTFEIEDLFENLKAIYNSIEQNKPIGVKGRYFKTLYICTTMGPSIQIDYTLF- 228
189095317 159 KIEYKADRTGIVHLNFGKSNFTNEQLLQNLLAFYNSVEQNKPSGVKGKYFKSFYICNTMGPSIQIDLTSMV 229
11465492  161 KLEYRTDKSGIVHSIIGKIDFTAEDLLNNLIAIKKSIDQNRPNGAKGKYWKNMYLCTTMSPAIKIDFNKLQ 231
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap