Conserved Protein Domain Family
psbW

?
CHL00128: psbW 
photosystem II protein W; Reviewed
Statistics
?
PSSM-Id: 177050
View PSSM: CHL00128
Aligned: 16 rows
Threshold Bit Score: 194.89
Threshold Setting Gi: 269101016
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
11465484    1 MAKIQFIKGIDEQTVPEIRLTRSRDGNTGTAIFSFINPTVflLHSSSQNYGEITGMYLQDDEGELSTRNVTANFVNGKPK 80 
149072107   1 MAVIQFIQGVNEDVIPDVRLTRSRDGSTGTATFRFANPQV--LEAQTTNKGTITGMYLIDEEGQIVTRDVNARFVNGKPQ 78 
11467376    1 MAKIQFIQGVDEEAIPDVKLSRSQDGANGIAKFYFDKPTV--FDVY---QGEITGLYLIDEEGELSTRTVYAKFINGKPQ 75 
118411187   2 IARIQFIKGIDEKVLPDVRLTRSRDGSTGTATFLFKNANL--INKSLALNGEITGMYMIDEEGILETRDVSARFVNGKPQ 79 
11467617    1 MAVIQFIQGVNEDVIPDVRLTRSRDGSTGTATFRFANPKV--LEAQSSVKGNITGMYLIDEEGQLVTRDVNARFVNGKPQ 78 
215400731   2 GAKIQFIQGINEINIPRVKLTRSQNGTTGTATFLFTNSSL--FNNESSKQGEITGMFLIDNEGILTTKDVNVRFKNGQPI 79 
51209899    1 MAVIQFIKGINETVVADVSLTRSRDGSKGTATFRFNNPDI--LKSGMEDKGDITGMYLKDDEGELMTRDVSAKFINGKPQ 78 
30468121    1 MASIQFIQGVDEDIIPTVRLTRSRDGQTGTAVFRFVQPKL--LQQ----QGEITGMYMIDEEGEIVTREVQAKFVNGQPQ 74 
90994538    1 MATIQFIQGINEEVVPDVRLTRSRDGSTGTATFRFTNPKI--LDASMADKGEITGMYLMDTEGQIITRDVNAKFINGKPQ 78 
11465813    1 MATIQFIQGINEEVVPDVRLTRSRDGSTGTATFRFTNPKI--LDASMADKGEITGMYLMDTEGQIITRDVNAKFINGKPQ 78 
11465484   81 AVEAVYLIRNKSGWDRLMRFINKYAEDKNMSFYKS 115
149072107  79 GIEAVHIMQSKEDWDRFMRFMERYSEDNGLTFTKA 113
11467376   76 SIEASYIMNNREEWERFIRFMERYAKQNDLSFTKA 110
118411187  80 AVESIYIMKSPEAWDRFMRFMERYGESNGLAFTKA 114
11467617   79 GIEAVYIMQSKEDWDRFMRFMERYSEDNGLSFTKA 113
215400731  80 NIEALYIMTNPTNWDRFMRFMERYAKENGLTFIKK 114
51209899   79 AVEAIYIIKSPQEWDRFMRFMEKYANENKLSFTKA 113
30468121   75 IIEALYVMKNAQAWERFMRFMNRYAEAKGLSFQRS 109
90994538   79 AIEAVHVIKSPDDWDRFMRFMERYAQDNGLTFTKA 113
11465813   79 AIEAVHVIKSPDDWDRFMRFMERYAQDNGLTFTKA 113
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap