Conserved Protein Domain Family
rpl11

?
CHL00127: rpl11 
ribosomal protein L11; Validated
Statistics
?
PSSM-Id: 177049
View PSSM: CHL00127
Aligned: 23 rows
Threshold Bit Score: 127.102
Threshold Setting Gi: 126022809
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
189095318   1 MPKKLTAIVKLALPAGKATPAPPVGPALGQHGVNIAGFCKEYNARTSDpeQNGLIIPVEISVFEDRSYSFILKTPPASVL 80 
301500948   1 MSKKLIGKVKLALSAGKATPSPPVGPALGSFGVNLASFCKQYNDQTSS--MTNTIVPAEITIYDDRSFTFVLKTPPTSLL 78 
11465493    1 MIKKIITTVKLALPAGKATPAPPVGPALGQHGVNIMMFVKEYNARTEE--QKGSIIPAEIQIYEDKSFTFILKTPPASIL 78 
11465803    1 MAKKVTGIVKLALNAGKATPAPPVGPALGQHGVNIVMFCKEYNARTAD--KTGLVIPVEISVYEDRSFSFILKTPPASVL 78 
301500897   1 -MKKLKTLLKLSLEAKKANPSPPVGPILGQYGVNLGLFCSTYNDLTKN--LEGI-VPVEISIFNDKSFTLNLKTAPTSIL 76 
11467314    1 MAKKVIAIIKIVLPAGKATPAPPVGPALGPYGVSSVNFCKEYNAKTAD--KGGLVIPAEITVYDDRSYSFVLKTPPASVL 78 
90994528    1 MAKKVTGIVKLALNAGKATPAPPVGPALGQHGVNIVMFCKEYNARTAD--KSGLVIPVEISIYEDRSFTFILKTPPASVL 78 
126022809   2 IMKKKLIKLKLTLEAGKATSNPPVGPLLGQYGININLFCKEYNNKTQK--YIGLKIPVIIIFYDPKKIILNLKTPSLSYL 79 
30468130    1 MGKKVLAVVKLALPAGKATPAPPVGPALGQYGVNLVMFTKEYNAKTAD--QIGLIIPAQITIYEDKSYSFILKTPPASVL 78 
51209889    1 MGKKLIGLVKLALNAGKATPAPPVGPALGQYGANIVMFCKEYNARTAN--KVGLVIPVEISIYEDRSFCFILKTPPAAVL 78 
189095318  81 LARAANISKGASEPNRKKVGSITQSQLEEIAKIKLPDLNTTKIDSAMLIVEGTAKNMGISIN 142
301500948  79 ILQAVSIKKGSANPKQSPAGRLTQQQLEEIARQKLPDLNTENLEVAKKIVSGTARNMGVSAM 140
11465493   79 LKQATGIEKATKAPRREQVGSISYKEIQNIAKIKINELNTKDLSKAIKIIEGTAKNMGISVE 140
11465803   79 IVKAAGLNKGSGEPNIKKIGSITTKQLESIAETKLPDLNTNNLSQAMKIVGGTAKNMGILIE 140
301500897  77 LLKQLKKTKGSSKPNLQKIGQLKISELFPIAETKLKELNTKNLTQAVLSIQGTAQSLGISIV 138
11467314   79 IAKAASVEKGSGEPNRKKVGSITKAQLEQIAKVKFPDLNTQNLEAASRIVEGTARNMGITIT 140
90994528   79 IAKAAGLNKGSGEPNTKKVGSITNKQLESIAETKLPDLNTNNIPQAMKIVGGTAKNMGILIK 140
126022809  80 I------------LNFKKSNFININNIKKILYIKKKEFYPISNKKYLYMIKGPLKSMNINIK 129
30468130   79 LKRAAQIEKGSN--NGTIVASITQEQLQQIALTKLPDLNTKDVKKAMSIISGTAANMGIQIL 138
51209889   79 LKKAAQIQSGSGQPNTKKIGSISLQQLEEIAKTKLQDLNTQDVKKAMKIVKGTAKNMGIKIN 140
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap