Conserved Protein Domain Family
psaE

?
CHL00125: psaE 
photosystem I subunit IV; Reviewed
Statistics
?
PSSM-Id: 177048
View PSSM: CHL00125
Aligned: 16 rows
Threshold Bit Score: 92.5359
Threshold Setting Gi: 51209908
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
11467751   1 MVKRGSKVRILRKESYWYQEVGTVATVDTSGIRYPVVVRFEKVSYSGVNTNNFSLDEVIEVNEK 64 
11465513   1 MIKKGSQVRILRPESYWHNEIGTVATVDQSGIRYPVIVRFDKVNYSGINTNNFAVNELVEIQTN 64 
269101028  1 MVTKGAKVRILRKESYWYNDVGTVVVIDKKAANYPVLIRFVKVNYSGTNTANFKLEELEVA--- 61 
11467377   1 MVQRGSKVRILRKESYWYQEIGTVASIDQSGIKYPVIVRFEKVNYSNVNSNNFSLDEVVEVEPP 64 
30468152   1 MIKKGSLVKILRPESFWYNEVGTVVNVETSKVLYPVLVRFDKVNYSGLNSTNFSLDELVEIKVE 64 
51209908   1 MIKKGSVVKVLRKESYWYQDIGTVVKVEKD-IKYPVLVRFVKETYSGVNSNNFSENELTLVVE- 62 
149072042  1 MVKRGSKVRILRKESYWYQDIGTVATIDTSGIRYPVVVRFEKVSYSGVNTNNFSLDEVVEVVAK 64 
11465792   1 -MERGSKVKILRKESYWYQEIGTVAAMDKSGIKYPVLVRFEKVNYNNVNTNSFADNELIDLGK- 62 
189095437  1 MVDRGSKVQILRKESYWYNKIGSVATVDQSGIRYPVVVRFDSVNYSGTNTNNFSLDEIIEVKP- 63 
299830571  1 MVNRGSVVKILRKESYWFNQTGTVATVDQSGIRYPVVVRFENVNYSGTNTNNFALDELVEVESG 64 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap