Conserved Protein Domain Family
acpP

?
CHL00124: acpP 
acyl carrier protein; Validated
Statistics
?
PSSM-Id: 177047
View PSSM: CHL00124
Aligned: 14 rows
Threshold Bit Score: 85.8428
Threshold Setting Gi: 215400828
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
215400828  6 TDYDNVYDKIRQIVIDQLQLEEEEeskLKPEASFTDDLGADSLDIVELILNLEDKFGIEIPDEVAKKITTLEEAAKLINE 85 
189095290  8 KTHADVLEKVREVVAEQFCLEQDE---FENDSHFMRDLGADSLDVVELVMTLEEIFEMEVSDEYTSKIQTVQEAADIISI 84 
189095354  8 KTHADVLEKVREVVAEQFCLEQDE---FENDSHFMRDLGADSLDVVELVMTLEEIFEMEVSDEYTSKIQTVQEAADIISI 84 
51209953   1 -MSSSIFDKVQNIVANQLGVEKDK---VTEDAKFAA-LGADSLDTVELVMAIEDAFSIDIPDEDAEKIANLSQAIEFIQH 75 
11467714   1 MNEQEIFEKVQTIISEQLGVDKSQ---VTKDANFANDLGADSLDTVELVMAIEEAFNIEIPDDAAEQISNLQQAVDFISQ 77 
30468154   1 MTEQQILDKVQSIVSEQLGVERSQ---ISPNASFTHDLGADSLDNVELVMAMEEEFDLEIPDSAAEQITTIQQAVDYILQ 77 
118411038  1 --MKDNFTRLQSIVGKQLGIDPSK---VKLESDFGRELGADSLDVVELVMAIEDEFEVNIEDQSASQIATVQDVLNYLER 75 
11465516   2 VTKEEILKKVQSIVSEQLGISKEQ---VLVDSHFTNDLGADSLDNVELVMAIEEEFNIVISDIDAEKISNVREAVEFIID 78 
149072007  1 MNEQEIFEKVQTIISEQLGVEKSQ---VTKDANFANDLGADSLDTVELVMAIEEAFNIEIPDETAEQISNLQQAVDFISQ 77 
283794895  1 MNEQEIFDKVQGIISEQLGVERKQ---VTAEANFANDLGADSLDTVELVMAIEDAFNIEIPDETAEQISNLQQAVDFIKG 77 
215400828 86 KINKK 90 
189095290 85 IVNAD 89 
189095354 85 IVNAD 89 
51209953  76 AIDKK 80 
11467714  78 KVAA- 81 
30468154  78 HKKSL 82 
118411038 76 N---- 76 
11465516  79 KINNK 83 
149072007 78 KVAA- 81 
283794895 78 KLAV- 81 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap