Conserved Protein Domain Family
rps6

?
CHL00123: rps6 
ribosomal protein S6; Validated
Statistics
?
PSSM-Id: 177046
View PSSM: CHL00123
Aligned: 14 rows
Threshold Bit Score: 106.24
Threshold Setting Gi: 11467411
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
11467411    8 KPSKKITYRTTYILKPSLTEEEITKEIEDYQKLLIDNGAEDIIIENTGKCRLAYLINKQNDGIYFQITYRGANTLVNILQ 87 
90994550    5 ENIQLNCYETVYILKSDLNEDKTLSIINDYKSMLTNGGAKNIVLQHRGRRHLSYTINDYHDGIYVQVNYEGNGQLVKSFE 84 
11467648    1 -MTKLNSYETLYIVKPELTEDSLAKLIESYQGLLLERGAKNIITQNRGRRTLKYMIKKYKDAHYVQMNYEGNGEVIQLLE 79 
11465825    8 QEIKLNWYETVYLIKSDLNEDRTLCIINEYKSMLTNGGAKNIILQHRGRRHLSYSIKDYRDGIYVQVNYEGNGKLVQSFE 87 
118411090   1 -MPLLRKYEIMILLTEEFNDSELKTWVFNYAKNLRKFSVCDISVISRGKHNLAYPIETKMKGNYIQLNFSSMPKYITNFS 79 
51209874    1 --MNLNKYETIYILQPNITESENLILINEYKALIKKYGGNNIVVQHKGRRHLNYNIKSYYDGIYVQINYTASSNLVRILE 78 
30468113    5 MKKPWIEYELMWLIRPDLNQEEIKKEIEAVMKVLEE--SRRVQLNGKTTRKLAYKIGKYEEGHYVQMEFDGYGRIVKKLE 82 
299830577   1 -MSILRKYEIMILLTEEFNDSELKTWVFNYAKNLRKFNVCDISVISRGKHNLSYPINNCAKGNYIQLNFSSMPKYINNFS 79 
149071980   1 MDALLTSYETIYIIKPNLSEDNLLKIIENYQGLLIERGAKNIVTQNRGRRGLKYLINKFRDGVYIQMNYEANGEVVDFIE 80 
299830409   1 -MSILRKYEIMILLTEEFNDSELKTWVFNYAKNLRKFNVCDISVISRGKHNLSYPINNRGKGNYIQLNFSSMPKYINNFS 79 
11467411   88 RRMRLSINTLRYQTFKV 104
90994550   85 KSLRFDDNIIRYLTNKQ 101
11467648   80 RAMKINESIVRFLTTAI 96 
11465825   88 KSLRFDENIIRYLTNKQ 104
118411090  80 KTLKMDSNVLRFLVFNK 96 
51209874   79 KAMRLSQHVIRYMTIKN 95 
30468113   83 KYLQVNEKGLRYMILRK 99 
299830577  80 NLLKLDSNVVRFLVFNK 96 
149071980  81 KSMRINEDVIRFLTTRN 97 
299830409  80 NILKMDSNVVRFLVFNK 96 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap