Conserved Protein Domain Family
psaL

?
CHL00120: psaL 
photosystem I subunit XI; Validated
Statistics
?
PSSM-Id: 177043
View PSSM: CHL00120
Aligned: 18 rows
Threshold Bit Score: 208.359
Threshold Setting Gi: 11465558
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
189095382   1 MANFIKPYNNDPSVGHLSTPISNSAATRAFLGNLPAYRPGLSPLLRGLEVGMAHGYLLVGPFDKFGPLRNSPAALLIGFL 80 
90994413    1 MSEFIKPYNDDPFVGNLSTPVSTSSFSKGTSRNLPAYRRGLSPLLRGLEIGMAHGYFLIGPFDKLGPLRGTDVALLAGFL 80 
11465688    1 MAEFIKPYNDDPFVGNLSTPVSTSSFSKGLLGNLPAYRRGLSPLLRGLEIGMAHGYFLIGPFDKLGPLRGTDVALLAGFL 80 
269101129   1 MTSFIKPYNNDPSVGHLSTPVTSSAATKAYLGSLPAYRKGLSPLLRGLEIGMAHGYLLLGPFEKLGPLRGSEISLLIGFL 80 
51210002    1 MSDFIQSYNNDPFLGNLSTPVSTSTFTKGLLNNLPAYRRGLSPLLRGLEIGMAHGYFLVGPFDKLGPLRNTDVALLSGFL 80 
71842264    1 MSEFVKPYNNDPFVGNLSTPVTTSTATKLYLGNLPIYRKGLSPLLRGLEIGMAHGYFLIGPFYILGPLRNSPNALLVGLF 80 
242624362   3 KYTFVGPYGNDSSMGHLSTPITNSMLTRTLLGNLPIYRSGLSSTLRGLEVGMAHGYFLIGPFYKLGPLRNSEVALLAGYL 82 
215400798   1 MANFIKPYNNDPFVGHLSTPITTSLITKTFLGNLPIYRENLSPLFRGLEVGMAHGYLLVGPFEKLGPLRNSEVALLSGFV 80 
11465558    1 MINYIKPYGSNPFVGNLSTPVNSSKVTIWYLKNLPIYRRGLSPLLRGLEIGMAHGYFIIGPFYKLGPLRNTDLSLLSGLI 80 
30468248    1 MTDYIKPYNNDPFVGHLATPINSSSLTRAYLSQLPIYRRGVSPFLRGLEIGMAHGYFLIGPFVQLGPLRNTDIKYLAGLL 80 
189095382  81 SAIGLIIILTVCLTIYGNATFQTESsfydrfSNKELQTRSGWAQFRSGFLVGACGGASVAYLILSNLG 148
90994413   81 SSVGLIIILTTCLSMYGNVSFTRAD------SKDPLQTSEGWGQFTAGFLVGAVGGSGFAYLLLANIP 142
11465688   81 SSVGLIIILTTCLSMYGNVSFTRSD------SKDPLQTAEGWGQFTAGFLVGAVGGSGFAYLLLANIP 142
269101129  81 SSIGLITLLTVCLAMYGKVTFQESDnd--ivNKNDLLNGKNWNQFTSGFFVGSFGGVSFAYLILLNLD 146
51210002   81 SAVGLIIILTVCLSMYGNVSFDKDD------AKDLLQTTEGWGQFTAGFLVGAVGGSGFAYLLLANIP 142
71842264   81 SAFGLILILTLGLTIYGLASFQGTE------GGENLESAKGWRNFTSGFSIGAFGGASVAYVLLDNIS 142
242624362  83 SAIGLIIILGLALALYGTATYTEDDs----iMGDVVESKAGWQRFTGGFFIGALGSSGFAFLLLSQLS 146
215400798  81 SALGLIIILVLCLVIYGKASFQESPkaslkiTNQDLLTKEGWSQFTSGFSVGAFGGAGFAYLLLLNIT 148
11465558   81 AAIGLIIISSIAMIIYGIVTFDNSE------NNDKLQTANGWRQLASGFLLGAVGGAGFAYILLANNL 142
30468248   81 SAIGLIVILTLGMLLYGAVSFTNDS--------QDLESVDGWRQLASGFLLGAVGGAGFAYLLLTLFS 140
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap