Conserved Protein Domain Family
atpD

?
CHL00119: atpD 
ATP synthase CF1 delta subunit; Validated
Statistics
?
PSSM-Id: 177042
View PSSM: CHL00119
Aligned: 15 rows
Threshold Bit Score: 204.064
Threshold Setting Gi: 11465568
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
11467681    1 MIAMNNKLAQPYAMAFLEFSLDaKQTLDTTIADLTQIKTILHDSVDLSKTLSNPLLSIKAKKEVIKAIFEPNISKNTLKF 80 
242620033   3 SQILVSKISEPYADALLELAKS-NNCVDAITADVNDLLTFLTSVPILASYFENPVISLDKKKELVETVMGEKLNPFTLKF 81 
51209987    3 SQGFMSKIALPYAEALVESASS-ASALDQINQDLSLISEILNQSQELKTFFYNPLITTEIKKNVVSSLFTNQVHSLVIRF 81 
11465568    3 LLLTNSKIIYPYSEALFSIAKD-QEKFEVIKNDMELFVTFTKNLNGFKKFLETPLINKNKKIKVVKDVFSKILNSTTLNF 81 
242624347   3 NKVLVSKISEPYADALLELAKA-QNCTEAITSDITDILTLMSSVPELPNYLGNPVIAGNKKKEFIKKVLESKINPNTLKF 81 
11465709    3 SNNLVAKIAQPYASALLDLANE-KKAIEQISQDMKLIKDILLQSGKLKYFLANPLKTIEAKKQVIAATFGDQISENTLSF 81 
90994434    3 SNNVVIKIAQPYAVALLDLAKT-KKVTEKVSQDIQSIQNILAQSDKLKIFLANPLKTVEAKKEVIIATVGDQINENTLSF 81 
118411111   3 INPLASKIASPYARALYDFSVE-QNIMHQVTADFQNLDVFLAEVPTLMEYLGNPIVTATQKEALLTKTLKSQLNAETFKF 81 
71842281    1 --MLVVKIAVPYAEALLELANA-NSSLKETTNDINIVSQFLANSSDLKKFLGNPLITRDAKKGVLKDVLGEQIGEKTLTF 77 
149072065   1 MSSKNVKVAKPYADAFIEIANK-----GSVINDLNCIATALSESKDLQKAIANPLVSSAAKKDIIKSIFAGNVDENTVKF 75 
11467681   81 LLVLCDRGRSANLSSIIDNTIELAYKKASIEIAYVTTATAFSSNQQEALVEKLKSMTSTEQIKLNITVDKTLIGGFKVQI 160
242620033  82 LLFLIDRRRIAFFETIGERYLELVYEFADIKIVTVQTVVPLSYRQERRIIRELKEFTGAKEIRLIREVDKSILGGLVIKI 161
51209987   82 LLVLIDRRRIALLDVIISKYLELVYQLQSTVIAEVLTPVLLTDVQQSALINKIKDMTNSKTVKLVITIKPMLIAGFIIKI 161
11465568   82 ISILINKNRIMFVSNISEKYNQLVLKDKSVKLVKIACARQLSEKQAQALSEVLKHKFKCLSVKLIFNIEPELIAGFKIFI 161
242624347  82 LQFLIDRRRIVYLDAIGEKFLEQIWELEGIKVVKLQTVIPLSYEQEELLVSKLKEVTGFKEIQLVRKIDKDILGGMILQI 161
11465709   82 LMVLVDRKRISMLDVIAGKYLELAYAMESLTIANISTSIALNSDQENLLIDKIKAMTSAKEVKLVISVDPELIGGFTIQI 161
90994434   82 LMILVDRKRIGMLDAIASKYLELAYQMESLTIANINTSIALSPDQETLLTEKIKVMTKAKEVKLIISVEPELIGGFTIQI 161
118411111  82 LMVLVKRDRINLLPTIITTYLELVYKTASVKMIEVSTAFPFTTLQKLNLIKKLKELTNAREIRLVVTVDSSLIGGFLIKT 161
71842281   78 LMLLVDRGRIAYLDGIAYKFLELSYKEESIEIAKVTSSVQLSAQQQKTIAEKLKKITGAKQIKLALKVDPQLIGGFTIEI 157
149072065  76 MMVLCDRGRIEYLDAIAETALILAYKQASIEMAYVASSVKLSSAQTEALVDKLKAMTKADQIKLELKVDESLIGGFKVQI 155
11467681  161 GSKVIDTSIQGQLRQLASHLGSSAI 185
242620033 162 DSQVIDISLKGQLRQISSSLDTTLV 186
51209987  162 GSKTIDTSLYGRLKHISAYLNAVS- 185
11465568  162 ESQVIDVSLQGELKEFEWYLTK--- 183
242624347 162 DSQVIDMSLKGKLRQISNLLGTSLA 186
11465709  162 GSKVIDTSIRGQLKQMASHLDVAAM 186
90994434  162 GSKVIDTSIRGQLRQMASHLDVVVT 186
118411111 162 NSKVIDFTIKNQLENLAKHLDGVLE 186
71842281  158 GSKLIDTSIRGQLKQISTLLGAV-- 180
149072065 156 GSRIIDTSVQNQLKQLSSYLGASVA 180
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap