Conserved Protein Domain Family
rpl34

?
CHL00115: rpl34 
ribosomal protein L34; Reviewed
Statistics
?
PSSM-Id: 177039
View PSSM: CHL00115
Aligned: 14 rows
Threshold Bit Score: 42.4506
Threshold Setting Gi: 299830423
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
118411177  1 MTKRTLSNKTRSSIlKVSGFRARMATAQGRKIIRTRRQKGRKKLAIP 47 
118411229  1 MTKRTLSNKTRSSIlKVSGFRARMATAQGRKIIRTRRQKGRKKLAIP 47 
11465656   1 MTKGTLQGSKRKKI-RISGFRARMKTPSGRSILNERRRKGRKKIMAS 46 
90994381   1 MTKRTLQGSKRKKI-RVSGFRARMKTPCGRSILNSRRRKGRKKIMVS 46 
11467482   1 MTKRTLSNKTRYSIlKLSGFRARMSTAQGRKTLKARRKKGRKQLAVR 47 
11467420   1 MSKRTLEGSHRKKV-RKSGFLSRSQSPTGRRILKARRKKGRKMLVKY 46 
51209845   1 MSKGFSNGTNIKRV-RKSGFRARMSNSSGRKILNSRRRKQRKKIAL- 45 
299830586  1 MSKKTLSNKSRYSVlKLSGFRARMSTAEGRKTIRNRRKKGRKILAIR 47 
299830423  1 MSKKTLSNKSRYAVlKLSGFRARMSTAEGRKTIRARRKKGRKTLALR 47 
118411046  1 MTKRTLSNKSRYSVlKLSGFRSRMATPQGRKTIRNRRKKGRKNLTLR 47 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap