Conserved Protein Domain Family
rps4

?
CHL00113: rps4 
ribosomal protein S4; Reviewed
Statistics
?
PSSM-Id: 177038
View PSSM: CHL00113
Aligned: 135 rows
Threshold Bit Score: 173.478
Threshold Setting Gi: 11496535
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
108773080   1 MSRYIGPRLRIIRRIGK--LRGFTRKkpfrrsfrgrgalqgkvIPPGQHGLtkLFKsRPFdSNESDYLIRLKVKQRLRYN 78 
118411052   1 MSRYRGPKLKISRRLGT--LPGLTTKks-------------nkLNRPGKDGntDIG-----KKLTEYGVRLEEKQKLKFN 60 
31442364    1 MLRYLGPKLKKLKRLNIhmQPEFSTK-----------------YFILNTNK------YNNkMILSFYLLELFEKQKLKFT 57 
118411185   1 MSRYRGPKLRITRRLGD--LPGLTQKks-------------kkTTRPGQHG--KNL-GEGkKKTTEYGIRLEEKQKLKFN 62 
299830416   1 MSRYRGPKLKISRRLGT--LPGLTTKks-------------kkLNRPGKDG----NsPDMnKKLTEYGIRLEEKQKLKFN 61 
11467040    1 MSRYRGPRLRIVRRIGK--LPSLTNK-----------------TSKKRKSPgqPATsFKRkKKISKYNIRLKEKQKLRFN 61 
299830591   1 MSRYRGPKLKISRRLGS--LPGLTTKks-------------kkLNRPGKDG----NsPDTsKKLTEYGIRLEEKQKLKFN 61 
12545452    1 MVRYLGPHVKVIRKLGS--LRAFTKK-----------------KIKRYFKLdtKKRkLSFnKKTSKYKIRLKEKQKLRFN 61 
226968687   1 MARYRGPRVKIVRRLGE--LPGLTTK-----------------VPNRTYGPgqHGQ-ATStGKLTQFRVRLQEKQKLRYN 60 
11467476    1 MSRYRGPKLRITRRLGA--LPGLTQKqs-------------kkKGRPGQHG--KSNeADNsKKTTEYGIRLEEKQKLKFN 63 
108773080  79 YGITEKQLVKYVRQAKKMKESTGQVLLQLLEMRLDNIVFRLNMAPTICAARQLISHGHIHVNSKKVNIASYMCKPKDVIS 158
118411052  61 YGLTEKQLFRYVKEARRRQGVTGLILLQLLEMRLDTLCFTLGFAKSLAQARQLVNHGHITINKKVVSIPSFQCRLNDIIS 140
31442364   58 FSLSEKIIKKYILFMHKYN-YKKFNLINIIEIRLDNTIFNLGYSITIAQAKQLIIHGYFFVNFKLIKIPSFLLKKGDIIT 136
118411185  63 YGISENQLYHYIKEARRRNGVTGLILLQLLEMRLDTICFSLGYAPTIAAARQLVNHGHIIVNDKVIDIPSFQCQIGDVIG 142
299830416  62 YGLSESQLFRYVKEARRRKGVTGLILLQLLEMRLDTLCFNLGFASSIAQARQLVNHGHITVNNKVINIPSFQCRLKDIIS 141
11467040   62 YGITERQLLNYVKKSRKKKGSSGRFLLTFLEMRLDNIVHRIGFAPTIMAAKQLINHGHICVDDKVINIPSFICQPKSIIK 141
299830591  62 YGLTESQLFRYVKEARRRKGVTGLILLQLLEMRLDTLCFTLGFASSMAQARQLVNHGHITVNNKVINIPSFQCRLNDTIS 141
12545452   62 FAISEKQLFNYVKKAIKLKGSSGENLLVALEMRLDNIVYRLGLAPTIISSRQLINHGHIYVDGKVVNIPSFKCKPTNNIK 141
226968687  61 YGISEKQLLTYVRRARRAKGPTGEVLLQMLEMRLDSIVYRLGFAPTIRAARQYVSHGLITVNGQTVNIPSYNCLPGETIA 140
11467476   64 YGLTESQLYRYIKEARRRKGVTGLILLQLLEMRLDTICFTLGFAPTIASARQLVNHGHITVNDNVVSIPSFQCQINDVIG 143
108773080 159 V--SM----KQSSLKLVNRNLqEYSQkmsayKKRLERTLAYVLFQRnisPNMANAleYINQGKVQVNNRKVLLPNYLCHS 232
118411052 141 I--KE----KSSSKTLVETNI-KNNQ-----VREIPTHLRFDTVKL---EAIVLD--YCDRNDVSLQLDELLVIEHYSRR 203
31442364  137 LspKSyyifKLCKKNLYKKYI----K-----NSNIYDTIYICKNTL---ISIIYS--ILNI-YNNNNYNNILIMKYYSY- 200
118411185 143 I--KS----KSPAKKIIENNL-KTIN-----FSAPPAHLTFNKEKL---EGVVQN--YCDRSELLLDLNELLVIEYYSRR 205
299830416 142 V--KE----KSTSKNLVTTNL-KNNQ-----RNDLPSNLKFDANSL---TATVLD--YCNREDIPLQLDELLVIEHYSRR 204
11467040  142 P--KK----STVSENVIQKNI-ESKE-----LLLIPPHLSLNKKNL---EAKIIG--LINRKAISLIVNELLVIEFYSRK 204
299830591 142 V--KE----KSSSKNLIDANL-KNNP-----RSEIPSNLKFDSNSL---KATVLD--YCNREDIPLQLDELLVIEYYSRR 204
12545452  142 I--KD----NLVSKRIIEKNIeLLDK-----YFRAPSHLYFNKKKL---EAKVIN--MVKREDIKLIINELLIIEFYSRK 205
226968687 141 S----------TSNPVVENCK-TFG-------GAVPSHLTVDTAKT---TGKIQR--VITRSQIALTVNELLIIEFYSRK 197
11467476  144 I--KP----KATSKNLVEGNL-QTIK-----QVDLPTHLKFDKSKQ---EATVIN--YCDRNELLLNLDELLVIEYYSRR 206
108773080 233 K 233
118411052     -    
31442364      -    
118411185     -    
299830416     -    
11467040  205 V 205
299830591     -    
12545452  206 V 206
226968687 198 G 198
11467476      -    
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap