Conserved Protein Domain Family
rpl28

?
CHL00112: rpl28 
ribosomal protein L28; Provisional
Statistics
?
PSSM-Id: 177037
View PSSM: CHL00112
Aligned: 5 rows
Threshold Bit Score: 75.7355
Threshold Setting Gi: 51210004
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
11465690  1 MSKKCQLTGKVANNGYAVSHSHKRTKKLQNVNLQYKKVWSTEQNKWIKMLISTKAIKTLTKAL 63 
11467375  1 MARQCELTGKKANNGYTVSHSHRRTKCLQKANLQTKRIWSPTLKRWLKLQVSTKVIKDLKRKS 63 
90994415  1 MSKKCQLTGKVANNGYAVSHSHKRTKKLQKVNLQHKKVWSSGQNKWVKMLISTKAIKTLTQTL 63 
51210004  1 MVKECTLTGKKSNNGYTVSHSHIRTKKIQHINLQTKKIWSDKQKRWIKIKICTKAIKSLHKLK 63 
30468056  1 MSRVCPLTLKKCNHAFRVTYSHKRNHRRQFVNLQKKRIFIN--NEWVVLKISTKAIKTLKSKT 61 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap