Conserved Protein Domain Family
psbJ

?
CHL00108: psbJ 
photosystem II protein J
Statistics
?
PSSM-Id: 177036
View PSSM: CHL00108
Aligned: 153 rows
Threshold Bit Score: 41.8849
Threshold Setting Gi: 224179432
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
7525047    2 ADTTGRIPLWVIGTVAGILVIGLIGIFFYGSYSGLGSSL 40 
51210039   1 MAGTGRVPLWLVATVGGIAVITVLGIFIYGSYSGIGSSL 39 
11465854   1 MAGTGRIPLWLVATVGGMAAITVLGIFIYGSYSGVGSSL 39 
189095308  1 MAGTGRIPLWMVATVGGLGVIGVLSLFIYGAYSGLGSSL 39 
11467535   1 MSNTGRIPLWLVGLVGGLAVITMLSLFLYGAYSGLGSSL 39 
118410977  1 MANTGRIPLWLVGLVGGLAVITMLGLFIYGSYSGLGSSL 39 
299830632  1 MANTGRIPLWLVGLVGGLAVITVLSLFIYGSYSGLGSSL 39 
11465564   1 MNSTGRIPLWLVVTFGGIVVLTVLGIFIYGSYSGLGSSL 39 
299830297  1 MANTGRIPLWLVGLVGGLAVITMLSLFIYGAYSGLGSSL 39 
71842296   1 MSDVGRVPLWMVATVGGLAAGGLLILFVFGSYSGLGSSL 39 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap