Conserved Protein Domain Family
petL

?
CHL00106: petL 
cytochrome b6/f complex subunit VI
Statistics
?
PSSM-Id: 177035
View PSSM: CHL00106
Aligned: 99 rows
Threshold Bit Score: 24.5641
Threshold Setting Gi: 11466808
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
108773055  1 MLTITSYVGLLFTALGFTLGLYFGLTKVvKLI 32 
118410972  1 MTVAIDYFLLVGFCFAVTSGLWIGLKSI-KLI 31 
299830513  1 MTIAIDYFLLVGFCFALTSGLFLGLKSI-KLI 31 
149072070  1 MSILIGYIILLACAFGLAAGLFFGLSLI-KLI 31 
7524907    1 MVTIFSYIALLLSALVITLTCYIGLLKI-KLI 31 
118411162  1 MSILINYFLLVGFCFALASGLFLGLKSI-KLI 31 
299830302  1 MTVAIDYFLLVGFCFALTSGLFLGLKSI-KLI 31 
195976152  1 MLTITSYVGLLIGALVFTLGIYLGLLKVvKLI 32 
11467530   1 MTIAIDYFLLVGFCFAFTSGLYLGLKSI-KLI 31 
254798639  1 MVTVLSYISLLVVALVITLVFYLGLLKI-KLI 31 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap