Conserved Protein Domain Family
psaJ

?
CHL00105: psaJ 
photosystem I subunit IX
Statistics
?
PSSM-Id: 177034
View PSSM: CHL00105
Aligned: 100 rows
Threshold Bit Score: 59.2829
Threshold Setting Gi: 30468218
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
11467211   1 MRDIKTYLSVAPVLSTLWFGALAGLLIEINRLFPDALSFPF 41 
299830309  1 MEDLQKYLSTAPVLLTIWMTFTAGFIIEINRFFPDMLGLYF 41 
30468218   1 -MNLKKYLSTAPVVATLWLFLTAGILIELNRFFPDSLFY-- 38 
149072079  2 DSNFLKYLSTAPVLFTVWLSFTASFIIEANRFFPDMLYFPM 42 
11467523   1 MNDLQKYLSTAPVLLTLWMTFTAGFIIEINRFFPDMLGLYF 41 
11467661   2 DNNFLKYLSTAPVLLTIWLSFTAALVIEANRFYPDMLYFPI 42 
118410965  1 MENFQKYLSTAPVLLTIWLTFTAGFIIEINRFFPDLLGLYF 41 
118411169  1 MNDFQKYLSTAPVLLTLWMTFTAGFIIEVNRFFPDMLGLYF 41 
299830506  1 MEDLQKYLSTAPVLLTIWMTFTAGFIIEINRFFPDMLGLYF 41 
51209849   2 NNNLLKYLSTIPVVGAIWLTFTAGFIIEINRFFPDILSLSL 42 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap