Conserved Protein Domain Family
rpl33

?
CHL00104: rpl33 
ribosomal protein L33
Statistics
?
PSSM-Id: 177033
View PSSM: CHL00104
Aligned: 110 rows
Threshold Bit Score: 75.3957
Threshold Setting Gi: 71842239
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
121720634  1 MPKGKNPRVTVILECTSCVRNGanKKKESPGISRYITQKNRHNTPGRLELKKFCPYCYKHTIHGEIKK 68 
51209976   1 MSKSKGARIVITLEC--CCRNLnnITKKKSGIFRYTSTKNRKNTPNRIELMKFCPYCNKHQKFREIK- 65 
11467692   1 MAKGKGVRIVVTLEC-----------KTDQGVYRYHTTKNRRNTPNRIELKKYCPLTQQHEIFKEIK- 56 
149071993  1 MAKSKGARIVVTLEC-----------RSAEGVYRYTTTKNRRNNPNKMELKKYCPLSKKHEVFKEIK- 56 
187763122  1 MPAKTGPRVVVFLECFHCTQKG--AQKKFPGVFRYITKKNRHNKSTPLELKKFCPFCLKHTIHKERKK 66 
90994446   1 MAKSKGARIVITLECSDKAGEF--AQKRKPGVFRYTTTKNRRNTPSRIELNKFCPNCNQHCIFKEIK- 65 
34501392   1 MAKNKDVRVTITLECTNNCAQN--NEKKKLGVSRYTTQKNRRNTPTRLELKKFCSYCNKHTIHKEIKK 66 
11465721   1 MAKSKGARIVITLECSNKSVDI--SQKRKAGVFRYTTTKNRRNTPGRIELKKFCPNCNSHCVFKEIK- 65 
283794885  1 MAKNKSLRIVVTLES-----------KGYEGVFRYTTTKNKKNTPNRLELKKYCPLTKKHELFKEVK- 56 
71842239   1 MAK-KGARVQVTLEH-----------KCEQGVYRYHTTKNRRNTTDRLELKKYSPVTKQHEIFKEIK- 55 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap