Conserved Protein Domain Family
groEL

?
CHL00093: groEL 
chaperonin GroEL
Statistics
?
PSSM-Id: 177025
View PSSM: CHL00093
Aligned: 21 rows
Threshold Bit Score: 994.227
Threshold Setting Gi: 30468120
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
118411056   1 MAKKILYQDNARRALERGMEIMVEAVSVTLGPKGRNVVLEKSYGSPQIVNDGVTIAKEIKLLDHIENTGVSLIRQAASKT 80 
11467284    1 MAKQILYHESARRALEKGMDILAEAVAVTLGPKGRNVVLEKKFGAPQIVNDGVTIAKEIELEDHIENTGVALIRQAASKT 80 
11467406    1 MAKQILYHESARRALEKGMDILAEAVAVTLGPKGRNVVLEKKFGAPQIVNDGVTIAKEIELEDHIENTGVALIRQAASKT 80 
283794941   1 MSKTILYQENARRALERGMDILAEAVSVTLGPKGRNVVLERKYGAPQIVNDGVTIAKEIELDDHIENTGVALIRQAASKT 80 
149071973   1 MSKIILYQEDARRALERGMDILAEAVSVTLGPKGRNVVLERKYGPPQIVNDGVTIAKEIELEDHIENTGVALIRQAASKT 80 
90994540    1 MSKQILYQDDARKALEKGMDILTEAVSVTLGPKGRNVVLEKKFGAPQIINDGVTIAKEISLENHIENTGVALIRQAASKT 80 
11467618    1 MSKIILYQEDARRALERGMDILAEAVSVTLGPKGRNVVLERKYGAPQIVNDGVTIAKEIELEDHIENTGVALIRQAASKT 80 
71842244    2 GVKTILYQEDARKALERGMDILAEAVSVTLGPKGRNVVLEKKFGTPQIVNDGVTIAKEINLQDTLENTGVSLIRQAASKT 81 
11465815    1 MSKQILYQDDARKALEKGMDILTEAVSVTLGPKGRNVVLEKKFGAPQIVNDGVTIAKEISLEDHIENTGVALIRQAASKT 80 
11465483    1 MSKRILYKDQARKALERGIDVLAKAVSITLGPKGRNVVIDKKYGAPQIINDGIAIAKEIELKNHMENTGVSLIRQAAAKT 80 
118411056  81 NDVAGDGTTTATVLAYAMVKEGLKNVAAGANPISIKLGMEKASQYLVTQINEFAQPVEDIQSIQQVASISAGNDEIIGSL 160
11467284   81 NDVAGDGTTTATVLAYAMVKEGMRNVAAGANPMAIKRGIDRATQKVVETIAAHAKPVEDSRAITQVASISAGNDDEVGKM 160
11467406   81 NDVAGDGTTTATVLAYAMVKEGMRNVAAGANPMAIKRGIDRATQKVVETIAAHAKPVEDSRAITQVASISAGNDDEVGKM 160
283794941  81 NDVAGDGTTTATVLAHAMVKQGLKNVAAGANPIALKKGIEKATHFVINQISEYSRPVEDTLSIAQVATISAGNDEEVGKM 160
149071973  81 NDVAGDGTTTATVLAHAMVKQGMKNVAAGANPIAIKRGIEKATQFVISQIAEYSRPVEDTKSITQVAAISAGNDMEVGQM 160
90994540   81 NDVAGDGTTTATVLASAIVKQGMRNVAAGSNPMAIKKGIEKATNFVVSKIAEYAKPVEDTKAIIQVASLSSGNDIEVGKM 160
11467618   81 NDVAGDGTTTATVLAHAMVKQGMKNVAAGANAIALKRGIEKATQFIVTQIAEYARPVEDTRAISQVASISAGNDIETGKM 160
71842244   82 NDVAGDGTTTATVLAYAIIKQGMRNVAAGANPIVLKRGIEKATQFVVRKIMDYARPIENLTDITQVAQISAGNDAEVGSL 161
11465815   81 NDVAGDGTTTATVLASAIVKQGMRNVAAGSNPMAIKKGIEKATNFVVSKIAEYAKPVEDTTAIVQVASISSGNDAEVGKM 160
11465483   81 NDVAGDGTTTATVLAHAIIKQGLKYVSTGSNPISLKKGIEKASQFIIQKISENSRPIEDVKSIIQVSSISAGNDEEIGSM 160
118411056 161 IADALSKVGKEGVISLEEGKGIVTELEITEGMKLEKGFISPYFITNTEKMEVSYDNPYILLTDKRITLVqQDLLPILEQI 240
11467284  161 IADAIEKVGKEGVISLEEGKSTTTELEITEGMRFDKGYISPYFVTDPERMEVIQKDAMFLITDKKITLV-QDLVPILEQV 239
11467406  161 IADAIEKVGKEGVISLEEGKSTTTELEITEGMRFDKGYISPYFVTDPERMEVIQKDAMFLITDKKITLV-QDLVPILEQV 239
283794941 161 IANAIDKVGREGVISLEEGKSTVTELEMTEGMYFDKGYISPYMVVDTERMEVVQENPYILLTDKKITLVqQELVPILELA 240
149071973 161 IADAIEKVGREGVISLEEGKSTVTELELTEGMCFEKGFISPYFVTDTDRMEAAQENPYILLTDKKISLVqQELVPILELV 240
90994540  161 IANAIEKVGREGVISLEEGKSTNTILEITEGMQFEKGFISPYFVTDTERMEVLQENPFILFTDKKITLVqQELVPLLEQI 240
11467618  161 IADAIDKVGREGVISLEEGKSTITELEMTEGMCFEKGFISPYFVTDTERMEVIQDNPYILLTDKKITLVqQELLPTLELI 240
71842244  162 IANAIDKVGREGLISLEESKSTATELEITEGMGFDRGFISGYFVTNTERMEVVLDNPYILLTDKKITVVkQDLVPTLELV 241
11465815  161 IADAIDRVGREGVISLEEGKSTSTSLEITEGMQFEKGFISPYFVTDLDRMEVLQENPFILFTDKKITLVqQELVPLLEQI 240
11465483  161 IANAIQKVGKDGVISLEEGKSAITELEITQGMKFEKGYISPYFITNSEKMEVVLENPYILMTDKKITLVkEDLLPVLTLI 240
118411056 241 TKTKRPLLIIAEDVEKEALATLILNKLRGIINVVAVRAPGFGELRKQMLEDIAILTGGTVITQDAGLSLDNIQLNLLGQA 320
11467284  240 ARARKPLFIIAEDIEKEALATLVVNKLRGNLNVSAVKAPGFGDRRKAMMQDIAVLTNTQVISEQTGLRLDSIKLDVLGKA 319
11467406  240 ARARKPLFIIAEDIEKEALATLVVNKLRGNLNVSAVKAPGFGDRRKAMMQDIAVLTNTQVISEQTGLRLDSIKLDVLGKA 319
283794941 241 TKTGKPLLIIAEDVEKEALATLVVNKIRGVIDVVAVRSPGFGDRRKAMLEDISILTGGQVISEDAGFSLEALQLSMFGQA 320
149071973 241 SKTSRPLLIIAEDVEKEALATLVVNKLRGIVNVVAVRAPGFGDRRKTMLEDIAILTGGQVIAEDAGFSLETVQLDMLGQA 320
90994540  241 AKTSRPLLIIAEDIEKEALATIVVNKLRGILNVVAVRAPGFGDRRKSLLEDMSILTNGQVITEDAGLSLDTVQLDMLGKA 320
11467618  241 SKTSRPLVIIAEDVEKEALATLVVNKLRGIVNVVAVRAPGFGDRRKAMLEDIAILTGGQVISEDAGFSLETLTLDMLGQA 320
71842244  242 SKTNQPLLIISDNVEKEALATLIVNKLRGILNVVAVRAPGFGDRRKAILQDLAVLTGGDVITADAGLSLERMDIENLGVA 321
11465815  241 AKTSKPLLIIAEDIEKEALATIVVNKLRGILNVVAVRAPGFGDRRKSLLEDMSILTGGQVITEDAGFSLDTVQLDMLGKA 320
11465483  241 NKTNRPLLIIAEDVEKEALATLVINKLRGIVNVVAVRAPGFGDRKKALLEDIAILTNGQVISEETGLNLETITLDVLGQA 320
118411056 321 RRIIVNKDSTTIVSDGQTlNEINIRCEQLRKQVNIADTGYEKEKLQDRIAKLSGGIAVIRVGAVTETEMKDKKLRLEDAI 400
11467284  320 RQVNITKDYTTVIAEGNE-EGVSARCEQIRRQIEETDSAYEKEKLQERLAKLAGGVAVIKVGAATETEMKDKKLRLEDAI 398
11467406  320 RQVNITKDYTTVIAEGNE-EGVSARCEQIRRQIEETDSAYEKEKLQERLAKLAGGVAVIKVGAATETEMKDKKLRLEDAI 398
283794941 321 KRAIITKDGTTIIAEGND-KQIRSRCEQIRRQIDSSESSYEKEKLQERLAKLAGGVAVIKVGAATETEMKDKKLRLEDAI 399
149071973 321 RRITVTKEGTTIIAEGHE-REVKARCEQIRRQIEASESSYEREKLQERLAKLAGGVAVIKVGAATETEMKDKKLRLEDAI 399
90994540  321 RRVIVTKDSTTIIADGHE-IKVKSRCEQIKRQIETSDSLYEREKLQERLAKLSGGVAVIKVGAATETEMKDKKLRLGDAI 399
11467618  321 RRITITKENTTIIAEGNE-KDVKSRCEQIRRQIEASDSSYEREKLQERLAKLAGGVAVIKVGAATETEMKDKKLRLEDAI 399
71842244  322 RRVVVGKENTTIISDSNK-QEVLARCEQLRRQMETSDSTYEKEKLQERLAKLTGGVAVIKVGAATETEMKDRKLRLEDAV 400
11465815  321 RRVVVTKDSTTIIADGHE-ATVKSRCEQIKRQIETSDSLYEREKLQERLAKLSGGVAVIKVGAATETEMKDKKLRLEDAI 399
11465483  321 RRATILRDSTTIVEDKNQ-QAVHARCEQLKNQLLIAKSSYEKEKLQERLAKLIGGVAVIKVGAATETEMKEKKLRLEDSI 399
118411056 401 NATRAAVEEGIVPGGGATLTHLSENLVTWAKNNLKEDELIGAMIISRAILAPLRRIAENAGINGPVIIEKVQQQEFEIGY 480
11467284  399 NATKAAVEEGIVPGGGTTLAHLAIELENWVQSNLEHEELIGGMIVARSLTAPLKRIVENAGQNGAVIAEQVKDKPFNIGY 478
11467406  399 NATKAAVEEGIVPGGGTTLAHLAIELENWVQSNLEHEELIGGMIVARSLTAPLKRIVENAGQNGAVIAEQVKDKPFNIGY 478
283794941 400 NATKAAVEEGIVPGGGATLVHIMVDLGLWAKNHLTDEELIGALIVEKALAYPLRRIVENAGVHPSIIVEEVRNSNFSIGY 479
149071973 400 NATKAAVEEGIVPGGGATLIHFIEDLHDWAEDNLVEDELIGALIVEKALSAPMKRIIENTGINSSIIIEKIKAEEFSIGY 479
90994540  400 NATKAAIEEGIVPGGGATNVHISSELFTWAKNNLVEDELIGALIVERAVTYPLRRIAFNAGDNGAVIVEKVKSHDFHIGY 479
11467618  400 NATKAAVEEGIVPGGGSTLTHLANDLKDWAEDNLIEDELIGALIVERSLTSPLRRIIENTGQNSAIIIEQIKESEFNIGY 479
71842244  401 NATKAAVEEGIVPGGGTTLIHIAAELLEWVKETLTGDELLGGLIVEKALQAPLKKIALNAGENGSIIVERIKESDFEIGY 480
11465815  400 NATKAAIEEGIVPGGGSTNVHISGELFVWAKNNLFEDELIGALIVQRALTYPLRRIAFNAGDNGAVVVEKVKTNDFCIGY 479
11465483  400 NATKAAIEEGIVPGGGTALVHISANLKQWAKINLSSDELLGANIVEQASLAPLHKIAENSGKNGSLIVEALEHKNFEIGY 479
118411056 481 NAAKNTFGNMYTEGIVDPAKVTRSGLQNATSIASMILTTECIIVDDVKSS 530
11467284  479 NAANAQFVDMFEAGIVDPAKVTRSGLQNAASIAGMVLTTECIVVDKAESQ 528
11467406  479 NAANAQFVDMFEAGIVDPAKVTRSGLQNAASIAGMVLTTECIVVDKAESQ 528
283794941 480 NAFTGKMVDMFDEGIIDPAKVTRSALQNAASIASMILTTECIIVDKQE-- 527
149071973 480 NAAKGKIEDMYEIGVIDPAKVTRSAMQNAASIASMILTTECIVVDRKEEE 529
90994540  480 DAANGNIVNMYDRGIIDPAKVARSALQTQLLLQQWF-------------- 515
11467618  480 DAAKGEIVDMYDVGIIDPAKVTRSGLQNAASIASMILTTECIVVDKQDEK 529
71842244  481 NAATNEIVDMYEAGIIDPAKVTRSTLQNAASIASMILTTECIIVDKNKET 530
11465815  480 DASNGKIVNMYDAGIIDPAKVARSALQNATSIAAMVLTTECIVVDKLEA- 528
11465483  480 DALSNSLVDMYDAGIIDPAKVTRSAIQNAASIASMVLTTECVIVNRDKKN 529
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap