Conserved Protein Domain Family
apcE

?
CHL00091: apcE 
phycobillisome linker protein
Statistics
?
PSSM-Id: 164495
View PSSM: CHL00091
Aligned: 6 rows
Threshold Bit Score: 1466.59
Threshold Setting Gi: 30468176
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
90994454   1 MSIKASGGSPLARPQLYRTASILTITQAEQQDRFLQLGELNQLVSFLNSGQKRLEVADILTKNANILVARAADKIFVGGS 80 
51209968   1 MSVTATSGSPLVCPQLFRTASLSAIVQAEQQDRFLQLGELDQLVTFLKSGNKRLEVADILTKNANLLVSKAADKIFVGGS 80 
11465416   1 MGLRTSSGSPLVKPKLYKTSASNVISLAEKQDRFLNLGELTDLNTYFSSGNRRLDIAKVISLNANLIISRAADRIFVGGS 80 
30468176   1 MSVRRSSGSSFVSPKLYQTASFQVISNAEKQDRFLNLGELDQFVTYLRSGEKRLEIATVLSRNANTIVSAAADRIFVGGS 80 
11467303   1 -MTSVSGGSPLLRPQLYRTVTVSTILQADQQDRFLESGELSQLATYLTSGNKRLDIIITLTNNSEAIVSRAANRIFVGGS 79 
11465729   1 MSIKASGGSPLARPQLYRTASILTITQAEQQDRFLQLGELNQLVSFLNSGQKRLEVADILTKNANILVARAADKIFVGGS 80 
90994454  81 AISYLERPQAAVIIAGDQSSQDKINELSGNIQGDFgqsFRSLFNAGGA--TPPGFKPINVLRYGTTRMRKSLRDLDWFLR 158
51209968  81 PVSYLERPQASFLSINQLSNQSGLQNLSGDIQNNFfgiVSSTFSTSDS--LPAGFKPINIVRYGKNRMKKSLRDLDWFLR 158
11465416  81 PLSFLERPQAAVTLTSDQASSTSIQSTKGLGNGNI---FQNFFKSTSE--APTGFKPINVVRYGSSNMKKSIRDLDWFLR 155
30468176  81 PLSFLERPQAAVTLTPEQASATTVQPTQ--VRSNF---WRNLFSAG----VEAGFRPINVVRYGVSNMRKSLRDLDWFLR 151
11467303  80 PISYLERPQSGI--DAKLGTNSYVESQSGFLEG-----FRSLFNTGGAdiTPAGFKPINVSRYGITRMQKSLRDLDWFLR 152
11465729  81 AISYLERPQAAVIIAGDQSSRDKINELSGNIQGDFgqsFRSLFNAGGA--TPPGFKPINVLRYGTTRMRKSLRDLDWFLR 158
90994454 159 YLTYAIVSGDPNILSVNIRGLRELIDNACSSAAAIVALREMRRTALLIFEEDIKGQDLVKEYFNVVISEFEAPSLTDKLR 238
51209968 159 YLTYAIVAGDPNILSVNIRGLRDLIDNACSSAAAIVALREMRKIALSIFNEDSQGQELVKEYFDIIISEFDQSALTDKLR 238
11465416 156 YVTYAIVAGDTSILIVNTKGLRELIDKACSSSAAIVALKEMKNVSLSLFNYDIESQNIVRLYFNTLVSEFESPASSSKVR 235
30468176 152 YVTYAIVAGDASILEVNTRGLRELIDKACNSAAALVALKEMRRVSLTLFTSDKEASELVQNYFDTLINAFAAPTKADLVR 231
11467303 153 YITYAIVAGDPNILVTNIRGLREIIENACSSAVTLVALQEMRRASLSYFTKDASAEAIVKQYFDVVITEFLAPAPSDLVR 232
11465729 159 YLTYAIVSGDPNILSVNIRGLRELIDNACSSAAAIVALREMRRTALAIFEEDIKGQDLVREYFNVVISEFEAPSLTDKLR 238
90994454 239 KRISGDLQGLRLPQTYVQAGVSTPRFVMKPSLSADEKNIVVKACYRQIFERDIAKAYDLSLSNLESQVKNGQISIKEFIR 318
51209968 239 RRSSTDLQGLRLPQIYSQASILKQRFVMKTGLSSEEKNMVIKACYRQIFQRDISKAYGLNFTDLESQVKNGTLSLKEFIR 318
11465416 236 KRNSLDLQGLAIPDIYLVAADKSLRYVMKPNLSNTEKAQVIKACYRQVFERDIAKAYGLSLLELESKLKNLQISVKEFIR 315
30468176 232 RRSTVDAQGLKLPSIYRNN--IAPRYVMKPNLSSEERKQVIRACYRQVFERDIVFGYGLSLGELESKALQQQISIKEFIR 309
11467303 233 KRTSTSLQGLKLPQIYANAVVQKPRFQMKSTLSTTEKETVIKAVYRQIFERDVRRAYSLKNYDLESKVKNGQLSIKEFVR 312
11465729 239 KRESTDLQGLRLPQTYSQAGVSTPRFVMKSSLSADEKNTVVKACYRQIFERDIAKTYDLSLSNLESQVKNGQISIKEFIR 318
90994454 319 SLGTSSIYRKQFYEPFVNSRALELAFRHFLGRGPSSLEEFQKYFAILSSTGLSGLVNALLNSSEYTDYFGEETVPYFRNL 398
51209968 319 YLGKSYIYRKQFVQPFTNSRVIELAFRHFLGRGLSSLEEFKKYFGVLSSRGLDGLIDRLLNSNEYSDYFGEETVPYLRSL 398
11465416 316 ALGKSTLYRKNFYEGFTNSRVVELAFRHFMGRGLSSLQEFRKYFAILSSNGLDALIDSIINNSEYAEYFGEETVPYIRGY 395
30468176 310 ALGQSEIYRRQFYQPFVNSRVVELAFKHFLGRAPSSLKEWNEYFAIVSSRGLKGLVDALINSKEYADYFGEETVPYLRQL 389
11467303 313 ALGKSKLYAQQFYEPFINSRALELAFRHFLGRGPGSREEVQEYFALISKGGLPLLVDALVDSKEYEEYFGEEIVPYLRTL 392
11465729 319 SLGTSNIYRKQFYEPFVNSRALELAFRHFLGRGPSSLEEFQKYFAILSATGLSGLVNAILNSAEYADYFGEETVPYFRKL 398
90994454 399 GEEPQECRNWGPQIDLLTYSAPFRKVPQFITLFSDYKQSLPDQHPYGIGNDPLSIQFGAIFPKENKDPRKRQALFGKDTR 478
51209968 399 GEEAQEACNWGAQIDLLNYSTAFRKIPQFITLFSDYKAKLPDQHPYGLGNDPLLIQFGAIFAKNRINLRKKSSLFGKDTR 478
11465416 396 GQEAQECRNWGSQFALFKYSAPFRTIPQFITLFADYTQLPPSQHCYGKLNDPLNIQFGAIFKNSYVNEQSRPVLFPRGSR 475
30468176 390 GEEAQECRNWGAQLDLFNYSAPFRQVPQLITLYKDYESPLPQQHVYGRLNDPLPIRFGAIFARETVKPNPRPVNMGRDVK 469
11467303 393 GEEAQECRNWGAQIKLLNYSARFQKTPQFITLFAGYKNPLPDQHPYGQGNDPLEIQFGAIFPKETL--QTKAAFFGKDTR 470
11465729 399 GEEPQECRNWGPQIDLLNYSAPFRKVPQFITLFSDYKQSLPDQHPYGTGNDPLSIQFGAIFPKENKDPRKRQAIFGKDTR 478
90994454 479 RILVRRGPGIYNQISNPQVRPKSAGSLGPKIFKLSNALIKSdss---qnfENSVEVVTKVAYLRVFGREVYQEEKLILKP 555
51209968 479 RILPRSGPAIYSQISSPNLRSKSSGSLGPKIFQLNLSNQKD---------NTELEKVVRATYLRVFGRFIYEAEEITVKK 549
11465416 476 RILVYKGAGIFNQLGSPNALEKPPSNVSIAKWSK----------------ETDLNFILNAAYLRVFGRYVYEEEKIALRP 539
30468176 470 RIVIYQGAGINNERGTTNPCQLPSALPQDRLEA-----------------NAPIERQIQAAIIRVFGRDVYQEQKQWLKP 532
11467303 471 RILIRRGNGIDNQLSNPSARQKSPGSFGPKVFKLSSVASLNkntknvsfgETSTQAIIKAVYLQIIGRETYESQR--LKV 548
11465729 479 RILVRRGPGIYNQISNPQVRPKSAGSLGPKIFKLSNTLVATnss---anfENSVDVIAKVSYLRVFGREVYQEEKLLLRP 555
90994454 556 IESQLKDNQITVREFVRQLAKSSIFRSLYWEPLYICKAIEYIHNRLLGRPTYGRQEINKYFDIAYKQGYYQVIDTIIDSS 635
51209968 550 FEDLFRNRQISVREFVSKLTKSSVFRSLYWDNLYICKAIEYIHNRVIGRPTYGRQEINKYFDIVYKQGYYKMIDAMINSV 629
11465416 540 LENEFKRRSISVRDFVGQLAKSDVFRSLYWSRLYICKSIEYIHIRLLGRPTYGRTEINNYFDIVYKSGFYAFVDSLVNSR 619
30468176 533 LENELRRKTITLREFIRQLAKSDEFRNLYWSRLYVCKAIEYIHIRLLGRPTYGRREIEAYFDIAAKSGFYTLIDAMVDSE 612
11467303 549 WEIKLENGEISIREFVKQVAKSNLFRSLYWTPYYVCKSIEYINRRILGRPTYGRSEINKLFDIAAKKGFYALIDTLMDSP 628
11465729 556 IESQLQDGQISVREFIRQLAKSSIFRSLYWEPLYICKAIEYIHNRLLGRPTYGRQEINKYFDIAYKEGYYQVVDAIIDSP 635
90994454 636 EYTETFGDNTVPYERYSTPAGVALRSLRPGIIDQRFKKVIASKsaRFVELGTVKE--MRSSNDIQSRISQGVTSLRDQSI 713
51209968 630 EYIETFGNNIVPYERYITPYELAARKLRLSNNDQKYDTKISSE--FFQKLMLSSK--SPKQSSIMQKMKQGVTIKRDQQV 705
11465416 620 EYIKCFGNDTVPYDRYSTPEAVSSSIFRLSFINSVSYKSLKPKieKFIQLGVARD--AKSLSSLNSKVFQGVSQARSQKR 697
30468176 613 EYKRNFGDQTVPYDRYRAA---------LSSSASTSAIRSREEeaRFIQLAQAGKgyKPKKQGVQRIGQYELSLERQDRL 683
11467303 629 EYDESFGENTVPYERYLTPGGLALRIKRPNLSVSKEAK----NelRFIELGAINE--SRGERSIQLRIQQGVSKRREQTK 702
11465729 636 EYIETFGENVVPYERYTTPAGIALRSLRPGIIDQRFKKVISSKssRFVELGKVKE--IRSSNDIQSRIAQGVTALRDQSV 713
90994454 714 VFEVNSDSNKEMLEQALRAAYRQIFERDLNSFSVGGEFLDIKSAFLNRQICVKELVEKLALSELYGKEFYQPYPNTKVIE 793
51209968 706 IFTVDSSMDAASMFQILRAVYRQIFERDLNSFIVGDEFFNLEKAFVNRQITVRSLVEKLGSSSLYAKEFYQPYPNTKVIE 785
11465416 698 VFKVSDYSNVMNLRIVFYAALRQVFERNIEPYIKGGEFKDIESLFLSGKISVRELIKEIGSSSLYRKEFYIPFPNTQVIE 777
30468176 684 V--------------VFEAAVRQIFERNM---WANKELETLQVKFLQGEMSVRELVKALATTKLYVKEFYQPYPNTQVIE 746
11467303 703 IFKLNHHDDKVNLEKVIKAVYRQVFERDMDMYRIQNEFTVFESRLKNKEISVKEFVEALGQSQLYQKEFYTPYPNTKVIE 782
11465729 714 IFDVNQNSSQEVLEQALRAAYRQIFERDLNSFSIGGEFLDIESSFLNKQINVKELIQKLALSELYGKEFYQPYPNTKVIE 793
90994454 794 LGTKHILGRAPNNQAEIRFFNQILASKGLSAFISNLVESVEYNAVYGKDTVPYRRFPTLPAANFPNTETLYNRLTKQDIS 873
51209968 786 LGTKHFLGRAPNNQAEIRYFNQILASQGLAYFISTLVNSKEYEVIFGINTVPYRRFPTLPAANFPNTEKLYNRLTKQSKS 865
11465416 778 FCTKHFLGRAPKNQSEIRYYNQVLAVQGLREMINYMINSKEYLSVFGDDIVPYRRFPTLPAANFPNTQRLYSRQTKQNRN 857
30468176 747 LATKHILGRAVLNQAEIRYYNQILAREGLEAMVSRMVNSAEYRNLFGENQVPYRRFPTLPAANFPNTQKLYNRLTKQNRQ 826
11467303 783 LAMKHFLGRAPKNQIEIRKYNQLLASNGIAALIRSLVSSLEYAEVFGEDTVPYRRFPTFPATNFPNTEKLYNSLTKQTKT 862
11465729 794 LGTKHILGRAPNNQAEIRFLNQILASKGLSTFVETLVNSSEYDSVYGTNTVPYRRFPTLPAANFPNTETLYNRLTKQNVS 873
90994454 874 IVVPSFKKVLGNQ 886
51209968 866 IVIPSFISSSGNQ 878
11465416 858 IVVPSFSGLLNTV 870
30468176 827 LIVPSFGSRIDLT 839
11467303 863 ISNPSFAPEKTRR 875
11465729 874 VVVPSFKKVLGNQ 886
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap